Skip to main content

Recombinant Human Viperin GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00091543-Q01

Discontinued Product
H00091543-Q01 has been discontinued. View all Viperin products.

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 262-361 of Human Viperin

Source: Wheat Germ (in vitro)

Amino Acid Sequence: ALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Partial Recombinant Protein

Scientific Data Images for Recombinant Human Viperin GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00091543-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Viperin

Viperin is involved in antiviral defense. May impair virus budding by disrupting lipid rafts at the plasma membrane, afeature which is essential for the budding process of many viruses. Acts through binding with and inactivating FPPS,an enzyme involved in synthesis

Alternate Names

2510004L01Rik, cig33, cig5, Cytomegalovirus-induced gene 5 protein, interferon-inducible, radical S-adenosyl methionine domain containing 2, radical S-adenosyl methionine domain-containing protein 2, vig1, VIPERIN, Virus inhibitory protein, endoplasmic reticulum-associated

Gene Symbol

RSAD2

Additional Viperin Products

Product Documents for Recombinant Human Viperin GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human Viperin GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...