Skip to main content

Recombinant Human Tyk2 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00007297-Q01

Discontinued Product
H00007297-Q01 has been discontinued. View all Tyk2 products.

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Endotoxin Detection

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 276-375 of Human Tyk2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAFGQPADRPREPLWA

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Partial Recombinant Protein

Scientific Data Images for Recombinant Human Tyk2 GST (N-Term) Protein

SDS-PAGE: Recombinant Human Tyk2 GST (N-Term) Protein [H00007297-Q01]

SDS-PAGE: Recombinant Human Tyk2 GST (N-Term) Protein [H00007297-Q01]

SDS-Page: Recombinant Human Tyk2 Protein [H00007297-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00007297-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Tyk2

TYK2 - tyrosine kinase 2

Long Name

Protein tyrosine kinase 2

Alternate Names

EC 2.7.10, EC 2.7.10.2, JTK1, non-receptor tyrosine-protein kinase TYK2, tyrosine kinase 2

Gene Symbol

TYK2

Additional Tyk2 Products

Product Documents for Recombinant Human Tyk2 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human Tyk2 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...