Skip to main content

Recombinant Human TMEM49 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00081671-P01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00081671-P01-25ug
H00081671-P01-10ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-406 of Human TMEM49

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQYFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLIATYYVEGVHQQYVQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAESAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

72.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human TMEM49 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00081671-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: TMEM49

Transmembrane protein 49 (TMEM49), also known as vacuole membrane protein 1 (VMP1), is an endoplasmic reticulum (ER)-localized protein that plays an important role in autophagy and, specifically, autophagosome formation (1). TMEM49/VMP1 is synthesized as 406 amino acid (aa) transmembrane protein containing a VTT (VMP1-TMEM41b-TVP38) domain and with a theoretical molecular weight of 46 kDa (1,2). TMEM49 helps regulate ER contacts with membranes such as isolation membranes, mitochondria, endosomes, and lipid droplets (1). TMEM49/VMP1 deficiency leads to tighter ER contacts and, in the context of autophagy, results in failure of the autophagosome and lysosome to fuse and eventual disruption of autophagic flux (1).

TMEM49/VMP1 was first implicated in pancreatitis and its overexpression, together with KRAS oncogene activation, leads to development of pancreatic ductal adenocarcinoma (PDAC) (3). Aside from pancreatitis, TMEM49/VMP1 is also associated with a number of other pathologies including cancer, inflammatory bowel disease, and, potentially, neurodegenerative disorders such as Parkinson's Disease (PD) and Alzheimer's Disease (AD) (1). It is suggested that TMEM49/VMP1 deficiency in neurons results in disrupted autophagy and protein aggregation, increased ER-membrane contacts, and dysfunctional mitochondrial homeostasis, all of which contribute to neurodegeneration (1).

References

1. Wang, P., Kou, D., & Le, W. (2020). Roles of VMP1 in Autophagy and ER-Membrane Contact: Potential Implications in Neurodegenerative Disorders. Frontiers in molecular neuroscience, 13, 42. https://doi.org/10.3389/fnmol.2020.00042

2. Uniprot (Q96GC9)

3. Iovanna J. L. (2016). Autophagy Induced during Pancreatitis Promotes KRAS-Dependent Transformation in the Pancreas. Frontiers in oncology, 6, 226. https://doi.org/10.3389/fonc.2016.00226

Alternate Names

DKFZp566I133, EPG3, TDC1, transmembrane protein 49TMEM49, vacuole membrane protein 1

Gene Symbol

VMP1

Additional TMEM49 Products

Product Documents for Recombinant Human TMEM49 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human TMEM49 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...