Skip to main content

Thioredoxin-1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-48873PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-48873PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Thioredoxin.

Source: E. coli

Amino Acid Sequence: SLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48873.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-48873PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Thioredoxin-1

Thioredoxins (Trxs) are a group of small ubiquitous proteins that are key regulators of cellular redox balance. The mammalian Trx family includes the secreted and cellular protein (Trx-1), the mitochondria-specific Trx-2, the Trx-like cytosolic protein p32TrxL, a truncated version of Trx-1 known as Trx80, and the thioredoxin-related protein, TRP-14. Trx-1 is secreted by lymphocytes, hepatocytes, fibroblasts, and several tumor cells. Trx-1 acts as a growth factor an, antioxidant, a cofactor that provides reducing equivalents, and a transcriptional regulator. Expression of Trx-1 is increased under various stress conditions such as hypoxia and viral and bacterial infections. It also serves as a biomarker for rheumatoid arthritis.

Alternate Names

Thioredoxin1, Trx1, TXN, TXN1

Gene Symbol

TXN

Additional Thioredoxin-1 Products

Product Documents for Thioredoxin-1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Thioredoxin-1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...