Skip to main content

Tenascin C Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89639PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-89639PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TNC.

Source: E. coli

Amino Acid Sequence: RLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALDGPSGLVTANITDSEALARWQPAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPATEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89639.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89639PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Tenascin C

Tenascin, also known as hexabrachion and cytotactin, is an extracellular matrix protein with a spatially and temporally restricted tissue distribution. It is a hexameric, multidomain protein with disulfide linked subunits of 190 to 240 kD, originally characterized as 'myotendinous antigen.' In the embryo it is present in dense mesenchyme surrounding developing epithelia and in developing cartilage and bone. In the adult, tenascin remains present in tendons and myotendinous junctions in the perichondrium and periosteum, as well as in smooth muscle. Tenascin (TN)(Erickson and Bourdon 1989, Erickson 1993) is a high molecular weight, multifunctional, extracellular matrix glycoprotein, expressed in association with mesenchymal-epithelial interactions during development and in the neovasculature and stroma of undifferentiated tumors. It has been described under a variety of names: cytotactin, hexabrachion protein, J1-200/220, myotendinous antigen (MI), neuronectin (NEC1) and glioma mesenchymal extracellular matrix (GMEM). The TN molecule is a disulfide-linked hexamer. Human TN has 3 subunits of 190, 200 and 220 kDa. It is primarily made up of 14.5 epidermal growth-factor-like repeats, 15 units similar to the fibronectin type-III-homology repeat and, at the C-terminus, has a sequence with homology to the globular domain of the beta and gamma chain of fibrinogen. Monoclonal antibody reacting specifically with tenascin is an essential tool for the localization, identification and studies on the role of the molecule in epithelial-mesenchymal and neuronal-glial interactions (Castellucci et al. 1991, Balza et al. 1993).

Alternate Names

Cytotactin, HXB, Tenascin J1, TNC

Gene Symbol

TNC

Additional Tenascin C Products

Product Documents for Tenascin C Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Tenascin C Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...