Skip to main content

Recombinant Human SSBP2 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00023635-P01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00023635-P01-10ug
H00023635-P01-25ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-361 of Human SSBP2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDYSAAAAPSPVLGNIPPGDGMPVGPVPPGFFQPFMSPRYPGGPRPPLRIPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTPPRGMVPLGPQNYGGAMRPPLNALGGPGMPGMNMGPGGGRPWPNPTNANSIPYSSASPGNYVGPPGGGGPPGTPIMPSPADSTNSGDNMYTLMNAVPPGPNRPNFPMGPGSDGPMGGLGGMESHHMNGSLGSGDMDSISKNSPNNMSLSNQPGTPRDDGEMGGNFLNPFQSESYSPSMTMSV

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

65.45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human SSBP2 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00023635-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: SSBP2

SSBP2 is a gene that codes for a protein with five isoforms, with lengths of 361, 298, 341, 331, and 339 amino acids and weights of approximately 38, 31, 36, 35, and 36 amino acids respectively. The protein coded by SSPB2 is involved in the maintenance of genome stability. Current research is being done on several diseases and disorders linked to this gene including anorexia nervosa, carcinoma, leukemia, myeloproliferative disorder, lissencephaly, hematopoiesis, esophagitis, prostate cancer, and prostatitis. SSBP2 has also been shown to have interactions with LDB1, IL36RN, TAL1, DYRK2, and LDB2.

Alternate Names

DKFZp686F03273, HSPC116, Sequence-specific single-stranded-DNA-binding protein 2, single-stranded DNA binding protein 2, single-stranded DNA-binding protein 2, SOSS-B2, SSDP2

Gene Symbol

SSBP2

Additional SSBP2 Products

Product Documents for Recombinant Human SSBP2 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human SSBP2 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...