Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-90985
Key Product Details
Source
Tag
Conjugate
Applications
Product Specifications
Description
Source: HEK293
VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR (Accession #YP_009724390.1)
Purity
Endotoxin Level
Activity
Protein / Peptide Type
Scientific Data Images for Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein
ELISA: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985]
ELISA: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985] - Immobilized Recombinant SARS-COV-2 Spike S1 at 2ug/mL (100 uL/well) can bind Recombinant Human ACE2 with a linear range of 0.5-8.7 ng/mL.HPLC: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985]
HPLC: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985] - The purity of SARS-COV-2 Spike S1 Protein with His tag (Cat.NBP2-90985) was greater than 95% as determined by SEC-HPLC.SDS-PAGE: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985]
SDS-Page: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985] - Recombinant SARS-COV-2 Spike S1 Protein with His tag was determined by SDS-PAGE with Coomassie Blue, showing a band at 110-130 kDa.Formulation, Preparation and Storage
NBP2-90985
| Formulation | Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Lyoph |
| Reconstitution | Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20 to -70C. Avoid freeze-thaw cycles. |
Background: SARS-CoV-2 Spike S1
Given the critical role of the spike protein RBD in the interaction with the ACE2 receptor and viral entry, a number of neutralizing antibodies against the RBD have been developed as potential therapeutics for treating COVID-19 (3). These antibodies bind the RBD domain on the S1 subunit inhibiting the interaction with ACE2 (3). However, more studies need to be done as neutralizing antibodies can result in antibody-dependent enhancement, in which the viral entry and replication within the host cell is increased (4). One potential way to combat antibody-dependent enhancement is the use of nanobodies (4). Furthermore, there are currently several vaccine strategies that are in clinical trials, or recently federally approved, that utilize the spike protein in different forms (e.g. full length, S1 RBD, RBD-Fc, N-terminal) for protecting against SARS-CoV-2 infection (4,5). These vaccine strategies include DNA vaccines, viral vector-based vaccines, RNA vaccines, and subunit vaccines (4,5).
References
1. Pillay T. S. (2020). Gene of the month: the 2019-nCoV/SARS-CoV-2 novel coronavirus spike protein. Journal of Clinical Pathology. https://doi.org/10.1136/jclinpath-2020-206658
2. Malik Y. A. (2020). Properties of Coronavirus and SARS-CoV-2. The Malaysian Journal of Pathology.
3. Ho M. (2020). Perspectives on the development of neutralizing antibodies against SARS-CoV-2. Antibody Therapeutics. https://doi.org/10.1093/abt/tbaa009
4. Samrat, S. K., Tharappel, A. M., Li, Z., & Li, H. (2020). Prospect of SARS-CoV-2 spike protein: Potential role in vaccine and therapeutic development. Virus Research. https://doi.org/10.1016/j.virusres.2020.198141
5. Sternberg, A., & Naujokat, C. (2020). Structural features of coronavirus SARS-CoV-2 spike protein: Targets for vaccination. Life Sciences. https://doi.org/10.1016/j.lfs.2020.118056
Alternate Names
Gene Symbol
Additional SARS-CoV-2 Spike S1 Products
Product Documents for Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein
Product Specific Notices for Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.