RABL4 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-25088PEP

Catalog #
Availability
Size / Price
Qty
NBP3-25088PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Conjugate

Unconjugated

Applications

Antibody Competition

View all RABL4 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RABL4

Source: E.coli

Amino Acid Sequence: MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25088It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-25088PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: RABL4

Belonging to the small GTPase superfamily/Ras family, RABL4 possesses GTPase activity. More specifically, RABL4 encodes a GTP-binding protein that is a main component of the intraflagellar transport complex B. RABL4 interacts with HSPB11, AXIN2, CSNK1A1, CSNK1E and GSK3B. Biological processes associated with RABL4 include cilium assembly, kidney development and small GTPase mediated signal transduction.

Alternate Names

intraflagellar transport 27 homolog (Chlamydomonas), intraflagellar transport protein 27 homolog, member of RAS oncogene family-like 4, Putative GTP-binding protein RAY-like, RABL4, Rab-like protein 4

Gene Symbol

IFT27

Additional RABL4 Products

Product Documents for RABL4 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RABL4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy Policy
Cookie Policy
Site Map
© Copyright 2026 Bio-Techne. All Rights Reserved. All trademarks and registered trademarks are the property of Bio-Techne and its brands unless otherwise specified.