Skip to main content

Recombinant Human Prosurfactant Protein C GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00006440-P01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00006440-P01-10ug
H00006440-P01-25ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-197 of Human SFTPC

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDVGSKEVLMESPPDYSAAPRGRFGIPRCPVHLKRLLIVVVVVVLIVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALNRKVHNFQMECSLQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVNTLCGEVPLYYI

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

47.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Prosurfactant Protein C GST (N-Term) Protein

SDS-PAGE: Recombinant Human Prosurfactant Protein C GST (N-Term) Protein [H00006440-P01]

SDS-PAGE: Recombinant Human Prosurfactant Protein C GST (N-Term) Protein [H00006440-P01]

SDS-Page: Recombinant Human Prosurfactant Protein C Protein [H00006440-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00006440-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Prosurfactant Protein C

The SFTPC gene encodes pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. It is produced exclusively by type II alveolar epithelial cells in the lung. Pulmonary surfactant is a lipid-rich material that prevents lung collapse by lowering surface tension at the air-liquid interface in the alveoli of lung. Surfactant is composed of phospholipids and other surfactant-associated proteins (Clark and Clark, 2005 (PubMed 15927881)). See also SFTPA1 (MIM 178630), SFTPB (MIM 178640), and SFTPD (MIM 178635).(supplied by OMIM)

Alternate Names

PSP-C, pulmonary surfactant-associated protein C, Pulmonary surfactant-associated proteolipid SPL(Val), SFTP2, SFTP2pulmonary surfactant apoprotein-2 SP-C, SMDP2surfactant, pulmonary-associated protein C, SP-CSP5, surfactant protein C

Gene Symbol

SFTPC

Additional Prosurfactant Protein C Products

Product Documents for Recombinant Human Prosurfactant Protein C GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human Prosurfactant Protein C GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...