PIASy Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-17791PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-17791PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all PIASy/PIAS4 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIASy

Source: E. coli

Amino Acid Sequence: PYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17791.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-17791PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PIASy/PIAS4

The IL-6-type family of cytokines, which includes IL-6 as well as a number of similar cytokines and growth factors, plays a significant role in regulating gene activation, proliferation and differentiation. Transcription factors of the Stat family are known to be involved in this signal transduction pathway, undergoing phosphorylation, dimerization and translocation to the nucleus upon activation. PIAS 1, for protein inhibitor of activated Stat1 (also designated Gu/RNA helicase II binding protein), binds specifically to Stat1, blocking Stat1 DNA-binding activity and inhibiting Stat1-mediated gene activation. PIAS 1 also binds to the Gu/RNA helicase II enzyme, leading to the proteolytic cleavage of Gu/RH-II. PIAS 3 similarly binds specifically to Stat3, blocking Stat3 DNA-binding activity and inhibiting Stat3-mediated gene activation.

Long Name

Protein Inhibitor of Activated STAT, 4

Alternate Names

PIAS4, PIASG, ZMIZ6

Gene Symbol

PIAS4

Additional PIASy/PIAS4 Products

Product Documents for PIASy Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PIASy Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.