Skip to main content

Recombinant Human PI 3-Kinase p85 alpha GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00005295-Q01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00005295-Q01-10ug
H00005295-Q01-25ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 251-360 of Human PI 3-Kinase p85 alpha

Source: Wheat Germ (in vitro)

Amino Acid Sequence: IQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSN

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human PI 3-Kinase p85 alpha GST (N-Term) Protein

Recombinant Human PI 3-Kinase p85 alpha Protein [H00005295-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00005295-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: PI 3-Kinase p85 alpha

Phosphatidylinositol 3-kinase (PI3K) p85 alpha is a regulatory subunit that heterodimerizes with a catalytic subunit to form a Class IA PI3K enzyme complex, which plays an important role in the immune system (1,2). The P13K pathway is involved in many diverse processes including growth, metabolism, proliferation, and survival (2). PI3Ks are typically activated by cytokine receptors and are responsible for phosphorylation of the 3'-hydroxyl group of PI and its derivatives (3). p85 alpha is one of five regulatory subunit proteins which also includes p55 alpha, p50 alpha, p85 beta, and p55 gamma, and can bind to two of the three catalytic subunits (p110 alpha or p110 delta) (1,2). p85 alpha, p55 alpha, and p50 alpha proteins are all synthesized by the same PIK3R1 gene by alternative splicing (1). Structurally, PI 3-Kinase p85 alpha contains SRC homology 3 (SH3 domain), followed by a Bcr homology (BH) domain flanked by two proline-rich regions, then a N-terminal SH2 domain, an inter-SH2 domain, and C-terminal SH2 domain (1,2). PI 3-Kinase p85 alpha protein consists of 724 amino acids (aa) in length with a theoretical molecular weight of 83.5 kDa (2,4). The primary role for the p85 subunit is interaction with cell surface receptors and acts as an adapter for the stabilization and recruitment of the p110 catalytic subunit to the plasma membrane (1,3). Additionally, p85 has been shown to function in both interleukin-2 receptor (IL2R) and erythropoietin receptor (EpoR) endocytosis (3).

The PI3K pathway functions in a broad range of cellular processes, so it is understandable that pathway dysfunction can lead to an array of diseases and disorders (2,5). Elevated PI3K signaling is a key feature of many cancers (5). PI3K pathway dysregulation has also been implicated in neurological, metabolic, and cardiovascular disorders (5). Furthermore, both overactivation or under-activation of the PI3K delta (p85 alpha subunit + p110 delta subunit) pathway has been shown to cause immunodeficiency and pathologies related to immune system dysfunction (2). Therapeutics to target the PI3K pathway and treat related cancers include PI3K inhibitors and, specifically, isoform-selective inhibitors which have a lot of promise when used as part of a combination therapy (5).

References

1. Okkenhaug, K., & Vanhaesebroeck, B. (2001). New responsibilities for the PI3K regulatory subunit p85 alpha. Science's STKE : signal transduction knowledge environment. https://doi.org/10.1126/stke.2001.65.pe1

2. Nunes-Santos, C. J., Uzel, G., & Rosenzweig, S. D. (2019). PI3K pathway defects leading to immunodeficiency and immune dysregulation. The Journal of allergy and clinical immunology. https://doi.org/10.1016/j.jaci.2019.03.017

3. Chen, P. H., Yao, H., & Huang, L. J. (2017). Cytokine Receptor Endocytosis: New Kinase Activity-Dependent and -Independent Roles of PI3K. Frontiers in endocrinology. https://doi.org/10.3389/fendo.2017.00078

4. Uniprot (P27986)

5. Fruman, D. A., Chiu, H., Hopkins, B. D., Bagrodia, S., Cantley, L. C., & Abraham, R. T. (2017). The PI3K Pathway in Human Disease. Cell. https://doi.org/10.1016/j.cell.2017.07.029

Long Name

PI 3-Kinase p85 alpha

Alternate Names

GRB1, PI 3Kinase p85 alpha, PIK3R1

Gene Symbol

PIK3R1

Additional PI 3-Kinase p85 alpha Products

Product Documents for Recombinant Human PI 3-Kinase p85 alpha GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human PI 3-Kinase p85 alpha GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...