PBXIP1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-25042PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-25042PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Conjugate

Unconjugated

Applications

Antibody Competition

View all PBXIP1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PBXIP1

Source: E.coli

Amino Acid Sequence: PGVSANASKAWHQKSHFQNSREWSGKEKWWDGQRDRKAEHWKHKKEESGRERKKNWGGQEDREPAGRWKEGRPRVEESGSKKE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25042It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-25042PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PBXIP1

Hematopoietic PBX-interacting protein (HPIP) was identified in a yeast two-hybrid screen for factors that interact with PBX1, a homeodomain protein that regulates gene transcription during development and differentiation. Recently, HPIP has been reported to interact with estrogen receptor alpha (ERalpha) and estrogen receptor beta (ERbeta) and modulate ER target gene expression. Alternate names for HPIP include pre-b-cell leukemia transcription factor-interacting protein 1, hematopoietic PBX-interacting protein, and PBKIP1.

Alternate Names

Hematopoietic PBX-interacting protein, HPIPpre-B-cell leukemia transcription factor interacting protein 1, pre-B-cell leukemia homeobox interacting protein 1, pre-B-cell leukemia transcription factor-interacting protein 1

Gene Symbol

PBXIP1

Additional PBXIP1 Products

Product Documents for PBXIP1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PBXIP1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.