Skip to main content

OR11H1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-13693PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-13693PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OR11H1.

Source: E. coli

Amino Acid Sequence: MCPLTLQVTGLMNVSEPNSSFAFVNEFILQG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13693.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-13693PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: OR11H1

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers theperception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors(GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with manyneurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction ofodorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to theolfactory receptor genes and proteins for this organism is independent of other organisms. (provided by RefSeq)

Alternate Names

olfactory receptor 11H1, Olfactory receptor OR22-1, olfactory receptor, family 11, subfamily H, member 1, OR22-1, seven transmembrane helix receptor

Gene Symbol

OR11H1

Additional OR11H1 Products

Product Documents for OR11H1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for OR11H1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...