Skip to main content

NKX2.6 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-25018PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-25018PEP

Key Product Details

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NKX2.6

Source: E.coli

Amino Acid Sequence: LLSPVTSTPFSVKDILRLERERSCPAASPHPRVRKSPENFQYLRMDAEPRGSEVHNAGGGGGDRKLDGSE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25018It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-25018PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: NKX2.6

Members of the NK-2 family of homeodomain proteins are key regulators of growth and development in several tissues, including brain, heart and pancreas.Nkx-2.5, also designated cardiac specific homeobox protein (Csx), is a homolog of the Drosophila tinman protein and is essential for normal cardiovascular development. Expression of Nkx-2.5 during cardiomyogenesis is required for cardiac septation, in which a single atrium and ventricle are separated into four chambers. Nkx-2.5 binds to DNA as a monomer, a homodimer or as a heterodimer with Nkx-2.3 or Nkx-2.6, which suggests that the specific protein-protein interactions of Nkx-2.5 are involved in its transcriptional regulatory function. Nkx-2.6, also a homolog of the Drosophila tinman protein, is expressed in the caudal pharyngeal pouches,the caudal heart progenitors, the sinus venosus, the outflow tract of the heart and in a short segment of the gut between stages E8.5 and E10.5 of embryogenesis. Expression of Nkx-2.6 overlaps with that of Nkx-2.5 in the pharynx and heart. However, Nkx-2.6 mutant mice are viable and fertile, which suggests that Nkx-2.6 plays a compensatory function to Nkx-2.5.

Alternate Names

CSX2, NK2 homeobox 6, NKX2F, NKX4-2

Gene Symbol

NKX2-6

Additional NKX2.6 Products

Product Documents for NKX2.6 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NKX2.6 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...