Recombinant Human MYCL1/L-Myc GST (N-Term) Protein
Novus Biologicals, part of Bio-Techne | Catalog # H00004610-P01
Key Product Details
Source
Wheat germ
Tag
GST (N-Term)
Conjugate
Unconjugated
Applications
Western Blot, ELISA, Affinity Purification, Microarray
Product Specifications
Description
Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-206 of Human MYCL1
Source: Wheat Germ (in vitro)
Amino Acid Sequence: MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPSDSGKDLPEPSKRGPPHGWPKLCPCLRSGIGSSQALGPSPPLFG
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
48.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Protein / Peptide Type
Recombinant Protein
Scientific Data Images for Recombinant Human MYCL1/L-Myc GST (N-Term) Protein
12.5% SDS-PAGE Stained with Coomassie Blue.
Formulation, Preparation and Storage
H00004610-P01
| Preparation Method | in vitro wheat germ expression system |
| Formulation | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: MYCL1/L-Myc
MYCL1 is a member of the MYC family that was isolated from small cell lung carcinoma. Like the other members of the MYC family, MYCL1 is a proto-oncogene transcription factor belonging to the helix-loop-helix basic leucine zipper (HLH bzip) family. With its heterodimeric partners, MYCL1 binds to the DNA consensus site 5'-CACGTG-3'. MYCL1 is implicated in controlling a wide range of cellular processes from cellular proliferation to apoptosis.
Long Name
v-Myc Myelocytomatosis Viral Oncogene Homolog 1, Lung Carcinoma Derived
Alternate Names
L-Myc, LMyc
Gene Symbol
MYCL
Additional MYCL1/L-Myc Products
Product Documents for Recombinant Human MYCL1/L-Myc GST (N-Term) Protein
Product Specific Notices for Recombinant Human MYCL1/L-Myc GST (N-Term) Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...