MUC5AC Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-25001PEP
Key Product Details
Conjugate
Unconjugated
Applications
Antibody Competition
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MUC5AC
Source: E.coli
Amino Acid Sequence: LLSHNTKLTPMEFGNLQKMDDPTEQCQDPVPEPPRNCSTGFGICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCE
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
Purity
>80% by SDS-PAGE and Coomassie blue staining
Applications
Antibody Competition (10-100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25001It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation and Storage
NBP3-25001PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: MUC5AC
Given that MUC5AC is the primary mucin produced and secreted by cells lining airway, it is understandable that its expression is dysregulated in a number of respiratory diseases (1,3,5,6). For instance, MUC5AC is overexpressed in asthma and the protein is also more highly glycosylated, specifically fucosylated, in the disease state (1,3,7). Additionally, its overproduction is a key feature in chronic obstructive pulmonary disease (COPD) contributing to mucosal blockage (6). Multiple pathways are associated with overproduction of MUC5AC including NFkappaB, the primary pathway for production and secretion, and also the MAPK and STAT6 pathways (3). In addition to conventional, synthetic therapeutics agents, researchers are exploring natural MUC5AC inhibitors such as flavonoids, glycosides, and steroids to treat associated disorders (3).
References
1. Krishn, S. R., Ganguly, K., Kaur, S., & Batra, S. K. (2018). Ramifications of secreted mucin MUC5AC in malignant journey: a holistic view. Carcinogenesis. https://doi.org/10.1093/carcin/bgy019
2. Ballester, B., Milara, J., & Cortijo, J. (2019). Mucins as a New Frontier in Pulmonary Fibrosis. Journal of clinical medicine. https://doi.org/10.3390/jcm8091447
3. Samsuzzaman, M., Uddin, M. S., Shah, M. A., & Mathew, B. (2019). Natural inhibitors on airway mucin: Molecular insight into the therapeutic potential targeting MUC5AC expression and production. Life sciences. https://doi.org/10.1016/j.lfs.2019.05.041
4. Uniprot (P98088)
5. Li, J., & Ye, Z. (2020). The Potential Role and Regulatory Mechanisms of MUC5AC in Chronic Obstructive Pulmonary Disease. Molecules (Basel, Switzerland). https://doi.org/10.3390/molecules25194437
6. Bonser, L. R., & Erle, D. J. (2017). Airway Mucus and Asthma: The Role of MUC5AC and MUC5B. Journal of clinical medicine. https://doi.org/10.3390/jcm6120112
Alternate Names
gastric mucin, leB, lewis B blood group antigen, major airway glycoprotein, MUC5, mucin 5, subtypes A and C, tracheobronchial/gastric, mucin 5AC, oligomeric mucus/gel-forming, mucin 5AC, oligomeric mucus/gel-forming pseudogene, mucin-5 subtype AC, tracheobronchial, mucin-5AC, TBM, tracheobronchial mucin
Gene Symbol
MUC5AC
Additional MUC5AC Products
Product Documents for MUC5AC Recombinant Protein Antigen
Product Specific Notices for MUC5AC Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...