MRGX2 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33744PEP
Key Product Details
Source
E. coli
Conjugate
Unconjugated
Applications
Antibody Competition
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRGPRX2.
Source: E. coli
Amino Acid Sequence: ALQRALQDIAEVDHSEGCFRQGTPEMSRSS
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Antibody Competition (10 - 100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33744.
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation and Storage
NBP2-33744PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: MRGX2
MRGX2 (MAS-related GPR, member X2) is G-protein coupled 7-transmembrane protein that is selectively expressed in small-diameter sensory neurons of dorsal root ganglia. Human MRGX shares 41-52% amino acid identity with three other primate MRGX proteins, but has no ortholog in rodents. Binding of ligands such as cortistatin, proadrenaomedullin peptides (PAMP-12 and -20) and basic peptides (substance P, neuropeptide Y) to MRGX2 can activate Gq or Gi regulated pathways. MRGX2 is thought to influence nociception and promote adrenal gland catecholamine secretion and IgE-independent mast cell degranulation.
Long Name
Mas-related G Protein-coupled Receptor Member X2
Alternate Names
MRGPRX2
Gene Symbol
MRGPRX2
Additional MRGX2 Products
Product Documents for MRGX2 Recombinant Protein Antigen
Product Specific Notices for MRGX2 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...