LYVE-1 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38500PEP
Key Product Details
Source
Conjugate
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: FETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAA
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation and Storage
NBP2-38500PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: LYVE-1
LYVE-1 has been an important marker in studies of embryonic and tumor lymphangiogenesis, as many cancers are characterized by early metastasis to the lymph nodes (1-3, 5). One study of five different vascular tumors in infants used immunohistochemical analysis and found positive LYVE-1 expression in infantile hemangioma, tufted angioma, and kaposiform hemangioendothelioma (5). LYVE-1 along with other markers such as GLUT-1, CD31, CD34, Prox-1, and WT-1 can be used to help provide immunohistologic profiles of various tumors and, when used in conjunction with clinical and histopathologic approaches, may offer better overall diagnosis and disease treatment (5).
References
1. Jackson D. G. (2019). Hyaluronan in the lymphatics: The key role of the hyaluronan receptor LYVE-1 in leucocyte trafficking. Matrix Biology : Journal of the International Society for Matrix Biology. https://doi.org/10.1016/j.matbio.2018.02.001
2. Jackson D. G. (2004). Biology of the lymphatic marker LYVE-1 and applications in research into lymphatic trafficking and lymphangiogenesis. APMIS : acta pathologica, microbiologica, et immunologica Scandinavica. https://doi.org/10.1111/j.1600-0463.2004.apm11207-0811.x
3. Jackson D. G. (2003). The lymphatics revisited: new perspectives from the hyaluronan receptor LYVE-1. Trends in Cardiovascular Medicine. https://doi.org/10.1016/s1050-1738(02)00189-5
4. Unitprot (Q9Y5Y7)
5. Johnson, E. F., Davis, D. M., Tollefson, M. M., Fritchie, K., & Gibson, L. E. (2018). Vascular Tumors in Infants: Case Report and Review of Clinical, Histopathologic, and Immunohistochemical Characteristics of Infantile Hemangioma, Pyogenic Granuloma, Noninvoluting Congenital Hemangioma, Tufted Angioma, and Kaposiform Hemangioendothelioma. The American Journal of Dermatopathology. https://doi.org/10.1097/DAD.0000000000000983
Long Name
Alternate Names
Gene Symbol
Additional LYVE-1 Products
Product Documents for LYVE-1 Recombinant Protein Antigen
Product Specific Notices for LYVE-1 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.