Skip to main content

Recombinant Human KRTAP4-4 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00084616-P01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00084616-P01-10ug
H00084616-P01-25ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE

Product Specifications

Description

Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-166 of Human KRTAP4-4

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MVNSCCGSVCSDQGCGLENCCRPSYCQTTCCRTTCCRPSCCVSSCCRPQCCQTTCCRTTCCHPSCCVSSCCRPQCCQSVCCQPTCCRPQCCQTTCCRTTCCRPSCCRPQCCQSVCCQPTCCCPSYCVSSCCRPQCCQTTCCRTTCCRPSCCVSRCYRPHCGQSLCC

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

44.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human KRTAP4-4 GST (N-Term) Protein

SDS-PAGE: Recombinant Human KRTAP4-4 GST (N-Term) Protein [H00084616-P01]

SDS-PAGE: Recombinant Human KRTAP4-4 GST (N-Term) Protein [H00084616-P01]

SDS-Page: Recombinant Human KRTAP4-4 Protein [H00084616-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00084616-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: KRTAP4-4

This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the ultrahigh sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21. [provided by RefSeq]

Alternate Names

KAP4.13Ultrahigh sulfur keratin-associated protein 4.4, KAP4.4KRTAP4-13, keratin associated protein 4.4, keratin associated protein 4-13, keratin associated protein 4-4, Keratin-associated protein 4.13, Keratin-associated protein 4.4, Keratin-associated protein 4-13, keratin-associated protein 4-4, KRTAP4.13, KRTAP4.4, Ultrahigh sulfur keratin-associated protein 4.13

Gene Symbol

KRTAP4-4

Additional KRTAP4-4 Products

Product Documents for Recombinant Human KRTAP4-4 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human KRTAP4-4 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...