Skip to main content

Recombinant Human KLF15 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00028999-Q01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00028999-Q01-25ug
H00028999-Q01-10ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-78 of Human KLF15

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQALCSCYGGGLGTESQDSILD

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34.32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human KLF15 GST (N-Term) Protein

SDS-PAGE: Recombinant Human KLF15 GST (N-Term) Protein [H00028999-Q01]

SDS-PAGE: Recombinant Human KLF15 GST (N-Term) Protein [H00028999-Q01]

SDS-Page: Recombinant Human KLF15 Protein [H00028999-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00028999-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: KLF15

The kidney chloride channel proteins CLCNKA and CLCNKB are highly related, although they are located in different areas of the kidney. Using a yeast 1-hybrid screen of a kidney cDNA library with the GA element of the CLCNKA promoter as bait, Uchida et al. (2000) isolated cDNAs encoding MAZ and KLF15, which they termed KKLF. Sequence analysis predicted that the 415-amino acid KLF15 protein, which is 84% identical to the rat Klf15 protein, contains 3 zinc finger motifs at its C terminus, N-terminal serine-rich stretches, and a central proline-rich segment. EMSA analysis confirmed that KLF15 and MAZ interact with the GA element of the CLCNKA promoter and showed that KLF15 binds with higher affinity and is a functional competitor of MAZ. Northern blot analysis revealed highest expression of a 2.5-kb KLF15 transcript in liver, followed by heart, skeletal muscle, and kidney. No expression was found in bone marrow or lymphoid tissues. Western blot analysis showed expression of a 50-kD protein. Immunohistochemical analysis detected nuclear expression of KLF15 in liver sinusoid stellate cells, subcapsular fibroblasts, and portal fibroblasts. KLF15 was also expressed in cardiac and skeletal muscle interstitial cells and in kidney inner medulla, glomeruli, and cortical interstitium. Immunofluorescence microscopy, however, demonstrated no colocalization of KLF15 with CLCNKA.

Alternate Names

DKFZp779M1320, kidney-enriched Kruppel-like factor, KKLFKidney-enriched krueppel-like factor, Krueppel-like factor 15, Kruppel-like factor 15

Gene Symbol

KLF15

Additional KLF15 Products

Product Documents for Recombinant Human KLF15 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human KLF15 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...