Skip to main content

Recombinant Human GNA14 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00009630-Q01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00009630-Q01-25ug
H00009630-Q01-10ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 150-250 of Human GNA14

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKAL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human GNA14 GST (N-Term) Protein

SDS-PAGE: Recombinant Human GNA14 GST (N-Term) Protein [H00009630-Q01]

SDS-PAGE: Recombinant Human GNA14 GST (N-Term) Protein [H00009630-Q01]

SDS-Page: Recombinant Human GNA14 Protein [H00009630-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00009630-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: GNA14

GNA14, also known as Guanine nucleotide-binding protein subunit alpha-14, is a 355 amino acid that is 42 kDa, engaged as modulator or transducer in various transmembrane signaling systems. Disease research is currently being studied with relation to GNA14 and acanthocytosis fainting, chorea, pertussis, chagas disease, trypanosomiasis, thrombosis, hypertension, hypertension, susceptibility to neuronitis, neuroblastoma, and pancreatitis. This protein has been linked to many pathways such as development activation of ERK by Alpha-1 adrenergic receptors, molecular mechanisms of cancer, intracellular calcium signaling, visual cycle in retinal rods, CDK5 pathway, ERK5 signaling, GPCR downstream signaling, hemostasis, gastrin-CREB signalling pathway via PKC and MAPK, signaling by GPCR, signal amplification, Chagas disease (American trypanosomiasis), and amoebiasis pathways where it interacts with approx. 700 proteins including OPRL1, CHRM2, CCR1, CXCR1, and CXCR2.

Alternate Names

G alpha-14, G-protein subunit alpha-14, guanine nucleotide binding protein (G protein), alpha 14, guanine nucleotide-binding protein 14, guanine nucleotide-binding protein subunit alpha-14

Gene Symbol

GNA14

Additional GNA14 Products

Product Documents for Recombinant Human GNA14 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human GNA14 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...