Skip to main content

GM130/GOLGA2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89757PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-89757PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GOLGA2.

Source: E. coli

Amino Acid Sequence: DTPKDNAATLQPSDDTVLPGGVPSPGASLTSMAASQNHDADNVPNLMDETKTFSSTESLRQLSQQLNGLVCESATCVNGEGPASSANLK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89757.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89757PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: GM130/GOLGA2

Golgi Matrix Protein (GM130) is peripheral cytoplamic protein that is bound to the Golgi membranes. It has been implicated as a maintainer of cis-Golgi structure (1). During mitosis, it regulates the disassembly and reassembly of the Golgi complex. It is also linked to docking and fusion of coatomer (COP I) coated vesicles to the Golgi membrane (2). The COOH-terminal domain of GM130 is highly homologous to Golgi human auto-antigen, golgin-95. GM130 interacts specifically and GTP-dependent manner with Rab1b protein, a regulator of anterograde traffic between ER and Golgi membranes (3). GM130 is also activator of YSK1, an essential player in cell migration.

Long Name

Golgin A2

Alternate Names

GOLGA2, Golgin-95, SY11 Protein

Gene Symbol

GOLGA2

Additional GM130/GOLGA2 Products

Product Documents for GM130/GOLGA2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for GM130/GOLGA2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...