Recombinant Human GBL GST (N-Term) Protein
Novus Biologicals, part of Bio-Techne | Catalog # H00064223-P01
Key Product Details
Source
Wheat germ
Tag
GST (N-Term)
Conjugate
Unconjugated
Applications
Western Blot, ELISA, Affinity Purification, Microarray
Product Specifications
Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-326 of Human MLST8
Source: Wheat Germ (in vitro)
Amino Acid Sequence: MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
62.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Protein / Peptide Type
Recombinant Protein
Scientific Data Images for Recombinant Human GBL GST (N-Term) Protein
12.5% SDS-PAGE Stained with Coomassie Blue.
Formulation, Preparation and Storage
H00064223-P01
| Preparation Method | in vitro wheat germ expression system |
| Formulation | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: GBL
G-protein beta-subunit-like (GBL), also known as MTOR Associated Protein, LST8 Homolog (mLST8), is a 326 amino acid (aa) protein that is comprised of seven WD40 repeats and has a predicted molecular weight of approximately 36 kDa. The human protein shares 97% aa sequence identity with the mouse and rat orthologs. GBL binds the kinase domain of TOR and has been shown to stimulate its activity. GBL is found in both complexes formed by TOR, TORC1 and TORC2. It is required for TORC1-dependent phosphorylation of p70 S6 Kinase and IRS1 following stimulation with serum and insulin, and TORC2-dependent phosphorylation of Akt on Ser473 in response to serum, Insulin, and IFN-beta. GBL also negatively regulates TNF-alpha-induced NFkB activation via binding to IKK alpha and IKK beta. The physiological importance of GBL is highlighted by the fact that knockout mice display embryonic lethality, possibly due to defective vascular development. Additionally, female mice harboring heterozygous null mutations for both TOR and GBL have an increased life span, suggesting that GBL may also be involved in the aging process.
Long Name
G protein beta subunit-like
Alternate Names
mLST8
Gene Symbol
MLST8
Additional GBL Products
Product Documents for Recombinant Human GBL GST (N-Term) Protein
Product Specific Notices for Recombinant Human GBL GST (N-Term) Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...