Skip to main content

Recombinant Human FOXI1 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00002299-P01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00002299-P01-10ug
H00002299-P01-25ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-283 of Human FOXI1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPNPYLWFNGPTMTPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGGSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPAYVSGGSPTSHPLVTPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHFYNSVNTSGVLYPREGTEV

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

57.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human FOXI1 GST (N-Term) Protein

SDS-PAGE: Recombinant Human FOXI1 GST (N-Term) Protein [H00002299-P01]

SDS-PAGE: Recombinant Human FOXI1 GST (N-Term) Protein [H00002299-P01]

SDS-Page: Recombinant Human FOXI1 Protein [H00002299-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00002299-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: FOXI1

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it is possible that this gene plays an important role in the development of the cochlea and vestibulum, as well as embryogenesis. Mutations in this gene may be associated with the common cavity phenotype. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

FKHL10HFH3, forkhead box I1, forkhead box protein I1, forkhead-like 10, forkhead-related activator 6, Forkhead-related protein FKHL10, Forkhead-related transcription factor 6, FREAC-6, FREAC6FKH10, Hepatocyte nuclear factor 3 forkhead homolog 3, HFH-3, HNF-3/fork-head homolog 3, HNF-3/fork-head homolog-3, MGC34197

Gene Symbol

FOXI1

Additional FOXI1 Products

Product Documents for Recombinant Human FOXI1 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human FOXI1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...