Skip to main content

Recombinant Human Elastase GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00023436-P02

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00023436-P02-10ug
H00023436-P02-25ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-270 of Human ELA3B

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MMLRLLSSPLLVAVASGYGPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSWTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

55.44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Elastase GST (N-Term) Protein

SDS-PAGE: Recombinant Human Elastase GST (N-Term) Protein [H00023436-P02]

SDS-PAGE: Recombinant Human Elastase GST (N-Term) Protein [H00023436-P02]

SDS-Page: Recombinant Human Elastase Protein [H00023436-P02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00023436-P02
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Elastase

Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have sixelastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike otherelastases, elastase 3B has little elastolytic activity. Like most of the human elastases, elastase 3B is secreted fromthe pancreas as a zymogen and, like other serine proteases such as trypsin, chymotrypsin and kallikrein, it has adigestive function in the intestine. Elastase 3B preferentially cleaves proteins after alanine residues. Elastase 3Bmay also function in the intestinal transport and metabolism of cholesterol. Both elastase 3A and elastase 3B havebeen referred to as protease E and as elastase 1, and excretion of this protein in fecal material is frequently usedas a measure of pancreatic function in clinical assays. (provided by RefSeq)

Alternate Names

CBPP, cholesterol-binding pancreatic protease, chymotrypsin-like elastase family member 3B, chymotrypsin-like elastase family, member 3B, E1, EC 3.4.21, EC 3.4.21.70, EL-1, ELA3B, elastase 1, elastase 3B, pancreatic, Elastase IIIB, Elastase-3B, fecal elastase 1, pancreatic elastase 1, pancreatic endopeptidase E, Protease E, proteinase E

Gene Symbol

CELA3B

Additional Elastase Products

Product Documents for Recombinant Human Elastase GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human Elastase GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...