Skip to main content

DOK2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-43681PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-43681PEP

Key Product Details

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DOK2

Source: E.coli

Amino Acid Sequence: GDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKPRRCEAARKVIRLSDCLRVAEAGGEASSPRDTSAFFLETKERLYLLAAPAAERGDWVQAICLLAFPGQRKELSGPEGKQSRPCMEENEL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-43681It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-43681PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: DOK2

Docking proteins interact with receptor tyrosine kinases and mediate particular biological responses using signal transduction. DOK2 acts as a multiple docking protein downstream of receptor or non-receptor tyrosine kinases. By this mechanism it acts to negatively regulate signal transduction and cell proliferation controlled by cytokines in a feedback loop. DOK2 is highly expressed in cells and tissues of hematopoietic origin as well as in lung. Expression of bcr/abl induces additional tyrosine phosphorylation of the DOK1 and DOK2 proteins and their association with Ras-GAP. Thus, it is suspected that DOK association regulates GAP activity toward Ras and that the DOK proteins serve as mediators of bcr-abl signaling. The role of DOK proteins in bcr-abl regulation may also be implicated in chronic myelogenous leukemia (CML), which is characterized by a Philadelphia chromosome translocation t(9;22). Such a mutation would result in a p210-bcr/abl chimeric protein-tyrosine kinase which has been found in many CML cases.

Alternate Names

docking protein 2, docking protein 2, 56kD, docking protein 2, 56kDa, Dok-2, Downstream of tyrosine kinase 2, p56(dok-2), P56DOK, p56dok-2

Gene Symbol

DOK2

Additional DOK2 Products

Product Documents for DOK2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for DOK2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...