Recombinant Human DNMT3A GST (N-Term) Protein
Novus Biologicals, part of Bio-Techne | Catalog # H00001788-Q01
Key Product Details
Source
Wheat germ
Tag
GST (N-Term)
Conjugate
Unconjugated
Applications
Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE
Product Specifications
Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 803-912 of Human DNMT3A
Source: Wheat Germ (in vitro)
Amino Acid Sequence: RPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
37.95 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Protein / Peptide Type
Recombinant Protein
Scientific Data Images for Recombinant Human DNMT3A GST (N-Term) Protein
SDS-PAGE: Recombinant Human DNMT3A GST (N-Term) Protein [H00001788-Q01]
SDS-Page: Recombinant Human DNMT3A Protein [H00001788-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.Formulation, Preparation and Storage
H00001788-Q01
| Preparation Method | in vitro wheat germ expression system |
| Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: DNMT3A
References
1. Thakur, A., Mackin, S. J., Irwin, R. E., O'Neill, K. M., Pollin, G., & Walsh, C. (2016). Widespread recovery of methylation at gametic imprints in hypomethylated mouse stem cells following rescue with DNMT3A2. Epigenetics Chromatin, 9, 53. doi:10.1186/s13072-016-0104-2
2. Ravichandran, M., Lei, R., Tang, Q., Zhao, Y., Lee, J., Ma, L., . . . Dawlaty, M. M. (2019). Rinf Regulates Pluripotency Network Genes and Tet Enzymes in Embryonic Stem Cells. Cell Rep, 28(8), 1993-2003.e1995. doi:10.1016/j.celrep.2019.07.080
3. Pang, Y., Liu, J., Li, X., Xiao, G., Wang, H., Yang, G., . . . Ren, H. (2018). MYC and DNMT3A-mediated DNA methylation represses microRNA-200b in triple negative breast cancer. J Cell Mol Med, 22(12), 6262-6274. doi:10.1111/jcmm.13916
4. Xia, L., Huang, W., Bellani, M., Seidman, M. M., Wu, K., Fan, D., . . . Baylin, S. B. (2017). CHD4 Has Oncogenic Functions in Initiating and Maintaining Epigenetic Suppression of Multiple Tumor Suppressor Genes. Cancer Cell, 31(5), 653-668.e657. doi:10.1016/j.ccell.2017.04.005
Long Name
DNA [Cytosine-5-]-Methyltransferase 3A
Alternate Names
DNA (cytosine-5-)-methyltransferase 3 alpha, DNA (cytosine-5)-methyltransferase 3A, DNA cytosine methyltransferase 3A2, DNA Methyltransferase 3 Alpha, DNA methyltransferase HsaIIIA, DNA MTase HsaIIIA, Dnmt3a, DNMT3A2, EC 2.1.1.37, M.HsaIIIA, TBRS
Gene Symbol
DNMT3A
Additional DNMT3A Products
Product Documents for Recombinant Human DNMT3A GST (N-Term) Protein
Product Specific Notices for Recombinant Human DNMT3A GST (N-Term) Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...