Skip to main content

DNAJB11 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-84900PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-84900PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNAJB11.

Source: E. coli

Amino Acid Sequence: DSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84900.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-84900PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: DNAJB11

Members of the heat shock protein 40 (HSP 40) family of proteins all contain a highly conserved J domain that associates with HSP 70 and regulates the function of HSP 70 by activating its adenosine triphosphatase activity. ERdj3, an HSP 40 chaperone, is expressed in the ER lumen, where it interacts with BiP, a molecule involved in retrotranslocating proteins out of the ER. ERdj3 also associates with several other protein substrates, including unfolded light chains, a nonsecreted Ig light chain mutant and a VSV-G ts045 mutant. Shiga toxin (Stx) is a bacterial tool that enzymatically inactivates the 28S rRNA, inhibiting protein synthesis of infected cells. Stx also interacts with ERdj3 and Sec 61 to form a complex through which proteins are retrotranslocated to the cytoplasm. ERdj3 may play a role in the ER quality control system.

Alternate Names

ABBP-2, APOBEC1-binding protein 2, DnaJ (Hsp40) homolog, subfamily B, member 11, dnaJ homolog subfamily B member 11, DnaJ protein homolog 9, EDJABBP2, ER-associated DNAJ, ER-associated dnaJ protein 3, ER-associated Hsp40 co-chaperone, ERdj3DJ9, ERJ3, ERj3p, HDJ9, hDj-9, HEDJERj3, Human DnaJ protein 9, PRO1080, PWP1-interacting protein 4, UNQ537

Gene Symbol

DNAJB11

Additional DNAJB11 Products

Product Documents for DNAJB11 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for DNAJB11 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...