DBF4B Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-24777PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-24777PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Conjugate

Unconjugated

Applications

Antibody Competition

View all DBF4B Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DBF4B

Source: E.coli

Amino Acid Sequence: GKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSGKSFYLDLPAGKNLQFLTGAIQQLGGVIEGFLSKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPSRKPVDSV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24777It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-24777PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: DBF4B

DBF4B, also known as Protein DBF4 homolog B, consists of four isoforms of sizes 67.2 kDa, 47.2 kDa, 54.7 kDa, and 18.4 kDa and is involved in DNA replication and cellular generation by stimulating kinase activity. The protein has not been researched in association with any diseases. The protein interacts with PTEN, APC, CDC7, MDFI, and KRTAP4-12 proteins during the early S phase of cell cycle DNA replication.

Alternate Names

Activator of S phase kinase-like protein 1, activator of S-phase kinase-like protein 1, ASKL1CHIFB, ASK-like protein 1, chifb, Chiffon homolog B, DBF4 homolog B (S. cerevisiae), Dbf4-related factor 1, DRF1MGC15009, FLJ13087, protein DBF4 homolog B, ZDBF1B, zinc finger, DBF-type containing 1B

Gene Symbol

DBF4B

Additional DBF4B Products

Product Documents for DBF4B Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for DBF4B Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2026 Bio-Techne. All Rights Reserved.