Skip to main content

Recombinant Human Cytokeratin, HMW GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00051350-P01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00051350-P01-10ug
H00051350-P01-25ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-638 of Human KRT76

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MNRQVCKKSFSGRSQGFSGRSAVVSGSSRMSCVARSGGAGGGACGFRSGAGSFGSRSLYNLGSNKSISISVAAGSSRAGGFGGGRSSCGFAGGYGGGFGGSYGGGFGGGRGVGSGFGGAGGFGGAGGFGGPGVFGGPGSFGGPGGFGPGGFPGGIQEVIVNQSLLQPLNVEIDPQIGQVKAQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWELLQQQTTGSGPSSLEPCFESYISFLCKQLDSLLGERGNLEGELKSMQDLVEDFKKKYEDEINKRTAAENEFVGLKKDVDAAFMNKVELQAKVDSLTDEVSFLRTLYEMELSQMQSHASDTSVVLSMDNNRCLDLGSIIAEVRTQYEEIAQRSKSEAEALYQTKLGELQTTAGRHGDDLRNTKSEIMELNRMIQRLRAEIENVKKQNANLQTAIAEAEQRGEMALKDANAKLQDLQTALQKAKDDLARLLRDYQELMNVKLALDVEIATYRKLLEGEECRMSGECQSAVCISVVSNVTSTSGSSGSSRGVFGGVSGSGSGGYKGGSSSSSSSGYGVSGGSGSGYGGVSSGSTGGRGSSGSYQSSSSGSRLGGAGSISVSHSGMGSSSGSIQTSGGSGYKSGGGGSTSIRFSQTTSSSQHSSTK

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

92.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Cytokeratin, HMW GST (N-Term) Protein

SDS-PAGE: Recombinant Human Cytokeratin, HMW GST (N-Term) Protein [H00051350-P01]

SDS-PAGE: Recombinant Human Cytokeratin, HMW GST (N-Term) Protein [H00051350-P01]

SDS-Page: Cytokeratin, HMW Recombinant Protein [H00051350-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00051350-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Cytokeratin, HMW

KRT76, also known as Keratin, type II cytoskeletal 2 oral, is a 638 amino acid that is approx. 66 kDa, belongs to the intermediate filament family responsible for the structural integrity of epithelial cells, subdivided into epithelial keratins and hair keratins, and probably contributes to terminal cornification. Studies are being performed in relation to this protein and obstructive jaundice, pharyngitis, jaundice, cervical cancer, neuronitis, colorectal cancer, cervicitis, interferon and hepatitis. This protein has been shown to have interactions with ATG13, PDPK1, ULK2, GABARAP, and PRKAA1 in cytoskeleton organization pathways.

Alternate Names

CK-2P, cytokeratin 2, Cytokeratin-2P, HUMCYT2A, K2P, K76, keratin 76, keratin, type II cytoskeletal 2 oral, keratin-76, KRT2Bcytokeratin-2P, KRT2Pkeratin 2p, KRT76, Type-II keratin Kb9

Gene Symbol

KRT76

Additional Cytokeratin, HMW Products

Product Documents for Recombinant Human Cytokeratin, HMW GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human Cytokeratin, HMW GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...