Cyclin B2 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89657PEP
Key Product Details
Source
Conjugate
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: TVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLC
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation and Storage
NBP1-89657PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: Cyclin B2
Cyclin B2 (also CCNB2 and G2/mitotic-specific cyclin-B2) is a 45-46 kDa member of the Cyclin AB subfamily, cyclin family of proteins. It is widely expressed and associates with CDK1 providing substrate specificity to a phosphorylating complex. A phosphorCDK1:Cyclin B2 complex is associated with the Golgi apparatus, where it contributes to Golgi fragmentation during mitosis. It is also possible that Cyclin B2 can substitute for Cyclin B1 during the early stages of mitosis. Human Cyclin B2 is 398 amino acids (aa) in length. It contains two cyclin box folds (aa 201-290 and 298-383) and two substrate binding sites (aa 165-254 and 264-347). Phosphorylation occurs at Ser92, Thr94, Ser99, Ser204, Ser392 and Ser398. Over aa 1-101, human Cyclin B2 shares 79% aa identity with mouse Cyclin B2.
Alternate Names
Gene Symbol
Additional Cyclin B2 Products
Product Documents for Cyclin B2 Recombinant Protein Antigen
Product Specific Notices for Cyclin B2 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.