Skip to main content

CTHRC1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-31797PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-31797PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CTHRC1.

Source: E. coli

Amino Acid Sequence: AIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31797.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-31797PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CTHRC1

CTHRC1 (Collagen triple helix repeat-containing protein 1) is a 28-30 kDa, secreted glycoprotein that bears similarity to the C1q/TNFalpha-related family of proteins. It is expressed by disparate cell types, including renal epithelium, neurons, osteoblasts, and smooth muscle cells. Functionally, it is recognized to be induced by BMP-2 and to block TGF beta-induced collagen type I and III synthesis. Mouse CTHRC1 is 245 amino acids in length. It contains a 32 amino acid (aa) signal sequence, a 16 aa prosegment (aa 33-48), and a 197 aa mature region that shows one collagen-like domain (aa 59-92). Proteolytic processing may generate multiple CTHRC1 isoforms. There is the potential for an intracellular full-length 33 kDa, 245 aa form, plus extracellular isoforms that are 28 kDa (aa 33-245), 26 kDa (aa 49-245), 20 kDa (aa 98-245) and 18 kDa and 16 kDa in size, the last two representing variants of the 20 kDa form with C-terminal processing. CTHRC1 may undergo dimerization, trimerization and oligomerization. One mouse splice variant shows a deletion of aa 53-126. Full-length mouse CTHRC1 shares 99% and 93% aa sequence identity with rat and human CTHRC1, respectively.

Long Name

Collagen Triple Helix Repeat Containing 1

Alternate Names

NMTC1

Gene Symbol

CTHRC1

Additional CTHRC1 Products

Product Documents for CTHRC1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CTHRC1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...