CTHRC1 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-31797PEP
Key Product Details
Source
Conjugate
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: AIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRI
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation and Storage
NBP2-31797PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: CTHRC1
CTHRC1 (Collagen triple helix repeat-containing protein 1) is a 28-30 kDa, secreted glycoprotein that bears similarity to the C1q/TNFalpha-related family of proteins. It is expressed by disparate cell types, including renal epithelium, neurons, osteoblasts, and smooth muscle cells. Functionally, it is recognized to be induced by BMP-2 and to block TGF beta-induced collagen type I and III synthesis. Mouse CTHRC1 is 245 amino acids in length. It contains a 32 amino acid (aa) signal sequence, a 16 aa prosegment (aa 33-48), and a 197 aa mature region that shows one collagen-like domain (aa 59-92). Proteolytic processing may generate multiple CTHRC1 isoforms. There is the potential for an intracellular full-length 33 kDa, 245 aa form, plus extracellular isoforms that are 28 kDa (aa 33-245), 26 kDa (aa 49-245), 20 kDa (aa 98-245) and 18 kDa and 16 kDa in size, the last two representing variants of the 20 kDa form with C-terminal processing. CTHRC1 may undergo dimerization, trimerization and oligomerization. One mouse splice variant shows a deletion of aa 53-126. Full-length mouse CTHRC1 shares 99% and 93% aa sequence identity with rat and human CTHRC1, respectively.
Long Name
Alternate Names
Gene Symbol
Additional CTHRC1 Products
Product Documents for CTHRC1 Recombinant Protein Antigen
Product Specific Notices for CTHRC1 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.