Skip to main content

Recombinant Human CPSF6 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00011052-Q01

Novus Biologicals, part of Bio-Techne
Discontinued Product
H00011052-Q01 has been discontinued. View all CPSF6 products.

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 37-136 of Human CPSF6

Source: Wheat Germ (in vitro)

Amino Acid Sequence: ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEAS

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Partial Recombinant Protein

Scientific Data Images for Recombinant Human CPSF6 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00011052-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: CPSF6

CPSF6 - cleavage and polyadenylation specific factor 6, 68kDa

Alternate Names

CFIM, CFIm68, CFIM68CPSF 68 kDa subunit, CFIMcleavage and polyadenylation specific factor 6, 68kD subunit, cleavage and polyadenylation specific factor 6, 68kDa, Cleavage and polyadenylation specificity factor 68 kDa subunit, cleavage and polyadenylation specificity factor subunit 6, HPBRII-4, HPBRII-7, pre-mRNA cleavage factor I, 68kD subunit, pre-mRNA cleavage factor Im (68kD), Pre-mRNA cleavage factor Im 68 kDa subunit, Protein HPBRII-4/7

Gene Symbol

CPSF6

Additional CPSF6 Products

Product Documents for Recombinant Human CPSF6 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human CPSF6 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...