Chitinase 3-like 1/YKL-40 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-21409PEP
Key Product Details
Source
Conjugate
Applications
Product Specifications
Description
Source: E.coli
Amino Acid Sequence: DGLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHL
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
Protein / Peptide Type
Formulation, Preparation and Storage
NBP3-21409PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: Chitinase 3-like 1/YKL-40
Chitinase 3-like 1/YKL-40 (CHI3L1), also called BRP39 in mouse, is a 39 kDa glycoprotein member of the glycosyl hydrolase 18 family although it does not show chitotriosidase activity. CHI3L1 is expressed by articular chondrocytes, synovial cells, activated monocyte-derived macrophages, neutrophils, endothelial cells, vascular smooth muscle cells, and some cancer cells. CHI3L1 binds to chitin and heparins, and it enhances cell adhesion, proliferation and tumor angiogenesis. Circulating CHI3L1 is elevated during inflammation and connective tissue remodeling such as arthritis, chronic obstructive pulmonary disease, diabetes, cardiovascular disease, inflammatory bowel disease, and liver cirrhosis. It is frequently upregulated in glioblastoma, myxoid chondrosarcoma, melanoma and carcinomas of the breast, thyroid, colon, lung, kidney, and ovary.
Alternate Names
Gene Symbol
Additional Chitinase 3-like 1/YKL-40 Products
- All Products for Chitinase 3-like 1/YKL-40
- Chitinase 3-like 1/YKL-40 cDNA Clones
- Chitinase 3-like 1/YKL-40 ELISA Kits
- Chitinase 3-like 1/YKL-40 Luminex Assays
- Chitinase 3-like 1/YKL-40 Lysates
- Chitinase 3-like 1/YKL-40 Primary Antibodies
- Chitinase 3-like 1/YKL-40 Proteins and Enzymes
- Chitinase 3-like 1/YKL-40 Simple Plex
Product Documents for Chitinase 3-like 1/YKL-40 Recombinant Protein Antigen
Product Specific Notices for Chitinase 3-like 1/YKL-40 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.