CFTR Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16990PEP
Key Product Details
Source
Conjugate
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: FESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNSILTE
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation and Storage
NBP3-16990PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: CFTR
Cystic fibrosis transmembrane conductance regulator (CFTR) is a multi-pass transmembrane protein that functions as a chloride channel. CFTR belongs to the ATP-binding cassette (ABC) superfamily. Mutations in CFTR cause the pulmonary disease, cystic fibrosis (CF). Specifically, deletion of phenyalanine at position 508 (DeltaF508-CFTR) results in a folding defect which impairs chloride channel function. The mechanism by which channel dysfunction relates to disease symptoms is a focus of intense research. CFTR dysfunction results in disruption of ion transport and subsequent blockage of airways by secreted mucus. CFTR may also play a role in the skeletal muscle atrophy and dysfunction that characterizes CF. In addition, CFTR-mediated chloride secretion underlies fluid accumulation and cyst growth in autosomal dominant polycystic kidney disease (ADPKD).
Long Name
Alternate Names
Gene Symbol
Additional CFTR Products
Product Documents for CFTR Recombinant Protein Antigen
Product Specific Notices for CFTR Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.