Recombinant Human CD36 GST (N-Term) Protein
Novus Biologicals, part of Bio-Techne | Catalog # H00000948-P02
Key Product Details
Source
Tag
Conjugate
Applications
Product Specifications
Description
Source: Wheat Germ (in vitro)
Amino Acid Sequence: MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
Protein / Peptide Type
Scientific Data Images for Recombinant Human CD36 GST (N-Term) Protein
SDS-PAGE: Recombinant Human CD36 GST (N-Term) Protein [H00000948-P02]
SDS-Page: Recombinant Human CD36 GST (N-Term) Protein [H00000948-P02] - 12.5% SDS-PAGE Stained with Coomassie Blue.Formulation, Preparation and Storage
H00000948-P02
| Preparation Method | in vitro wheat germ expression system |
| Formulation | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: CD36
The expression of CD36 has been reported in platelets, erythrocytes, monocytes, differentiated adipocytes, skeletal muscle, mammary epithelial cells, spleen cells, some skin microdermal endothelial cells, and in cancer. Circulating levels of soluble CD36 (sCD36) has also been reported in chronic inflammatory disease such as type 2 diabetes and chronic kidney disease. CD36 participates in angiogenesis, innate immunity, and the clearance of apoptotic phagocytes. In lipid metabolism, CD36 functions as a macrophage receptor for oxidized LDL and as an adipocyte receptor/transporter for long-chain FFAs. Plasmodium falciparum, the parasite that causes malaria, binds CD36 via PfEMP1 proteins, tethering parasite-infected erythrocytes to endothelial receptors (5). Anti-CD36 isoantibodies have been detected in Type 1 CD36-deficient mothers and is implicated as the cause of fetal/neonatal alloimmune thrombocytopenia (6).
References
1) Febbraio, M., Hajjar, D. P., & Silverstein, R. L. (2001). CD36: a class B scavenger receptor involved in angiogenesis, atherosclerosis, inflammation, and lipid metabolism. The Journal of clinical investigation, 108(6), 785-791. PMID: 11560944
2) Silverstein RL, Febbraio M. (2000) CD36 and atherosclerosis. Curr Opin Lipidol. 2000 11(5):483-91. PMID: 11048891.
3) Endemann G, Stanton LW, Madden KS, Bryant CM, White RT, Protter AA. (1993) CD36 is a receptor for oxidized low density lipoprotein. J Biol Chem. 268(16):11811-6. PMID: 7685021.
4) Wang, J., & Li, Y. (2019). CD36 tango in cancer: signaling pathways and functions. Theranostics, 9(17), 4893-4908. PMID: 31410189
5) Hsieh FL, Turner L, Bolla JR, Robinson CV, Lavstsen T, Higgins MK. (2016) The structural basis for CD36 binding by the malaria parasite. Nat Commun. 7:12837. PMID: 27667267
6) Gruarin P, Ulliers D, Thorne RF, Alessio M. (2000) Methionine 156 in the immunodominant domain of CD36 contributes to define the epitope recognized by the NL07 MoAb. Mol Cell Biochem 214, 115-121. PMID: 11195795.
Alternate Names
Gene Symbol
Additional CD36 Products
Product Documents for Recombinant Human CD36 GST (N-Term) Protein
Product Specific Notices for Recombinant Human CD36 GST (N-Term) Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.