Skip to main content

Recombinant Human Caspase-1 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00000834-Q01

Catalog #
Availability
Size / Price
Qty
Loading...
H00000834-Q01-10ug
H00000834-Q01-25ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Endotoxin Detection

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human Caspase-1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Caspase-1 GST (N-Term) Protein

SDS-PAGE: Recombinant Human Caspase-1 GST (N-Term) Protein [H00000834-Q01]

SDS-PAGE: Recombinant Human Caspase-1 GST (N-Term) Protein [H00000834-Q01]

SDS-Page: Recombinant Human Caspase-1 Protein [H00000834-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00000834-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Caspase-1

Caspase-1, also known as interleukin-1-beta (IL-1beta) -converting enzyme (ICE), is a member of the cysteine-aspartic protease (caspase) family (1). The caspase family are aspartic proteolytic enzymes that play a key role in apoptotic cell death and inflammation (1). Caspase-1 is synthesized as an inactive proenzyme with a theoretical molecular weight of approximately 45 kDa and is 404 amino acids (aa) in length. The caspase-1 protein structure contains an N-terminal CARD (caspase recruitment domain), a large 20kDa P20 subunit (aa 120-297), and a small 10kDa P10 subunit (aa 317-404) (1, 2). The proenzyme undergoes cleavage at aspartic acid (Asp) residues to produce the active caspase-1 enzyme which exists as a heterotetramer (homodimer of the P20 and P10 heterodimers) (2). Inflammasome complexes sense various microbial and endogenous signals, including ligand-receptor interaction and growth factor deprivation, which results in the processing of pro-caspase to active caspase-1 (3, 4).The active caspase-1 is responsible for the cleavage and maturation of pro-inflammatory cytokines IL-1beta and IL-18, and promotes an inflammatory form of cell death induced by bacterial pathogens called pyroptosis (3, 4). Mature IL-1beta has a role in the immune reaction and recruiting inflammatory cells to the site of infection while IL-18 plays a role in interferon-gamma production and promotes cytolytic activity in natural killer cells (4).

Given the role of IL-1beta in inflammation, it makes sense that many diseases and pathologies have been associated with dysregulation of caspase-1 activation and the inflammasome (3, 4). The inflammasome is a multiprotein complex comprised of Nod-like receptor (NLR) family members and the adapter ASC (apoptosis-associated speck-like protein containing a CARD) which are crucial for capase-1 activation (3-5). For instance, the neuronal apoptosis inhibitory protein (NAIP)/NLRC4 inflammasome has been associated with colorectal cancer, breast cancer, and glioma pathogenesis (5). Caspase-1 activation and mutations in the inflammasome have also been linked to Chron's disease and Alzheimer's disease (4). In addition to immune and inflammatory related disorder, the inflammasome has been linked to metabolic and obesity related disorders including diabetes and cardiovascular disease (6). Finally, caspase-1 deficient mice exhibit enhanced epithelial cell proliferation in the colon, increased tumor formation, and reduced apoptosis (1). A more thorough understanding of the inflammasome-caspase-1 signaling pathway will be important for understanding disease pathology and potential therapeutic development.

Alternative names for caspase-1 includes CASP1, CASP1 nirs variant 1, EC 3.4.22.36, ICE, IL-1 beta-converting enzyme, IL1BC, IL1BCE, IL1B-converstase, interleukin-1 beta convertase, and p45.

References

1. Shalini, S., Dorstyn, L., Dawar, S., & Kumar, S. (2015). Old, new and emerging functions of caspases. Cell death and differentiation. https://doi.org/10.1038/cdd.2014.216

2. Chang, H. Y., & Yang, X. (2000). Proteases for cell suicide: functions and regulation of caspases. Microbiology and molecular biology reviews: MMBR. https://doi.org/10.1128/mmbr.64.4.821-846.2000

3. Vanaja, S. K., Rathinam, V. A., & Fitzgerald, K. A. (2015). Mechanisms of inflammasome activation: recent advances and novel insights. Trends in cell biology. https://doi.org/10.1016/j.tcb.2014.12.009

4. Franchi, L., Eigenbrod, T., Munoz-Planillo, R., & Nunez, G. (2009). The inflammasome: a caspase-1-activation platform that regulates immune responses and disease pathogenesis. Nature immunology. https://doi.org/10.1038/ni.1703

5. Kay, C., Wang, R., Kirkby, M., & Man, S. M. (2020). Molecular mechanisms activating the NAIP-NLRC4 inflammasome: Implications in infectious disease, autoinflammation, and cancer. Immunological reviews. https://doi.org/10.1111/imr.12906

6. Pham, D., Park, P. (2020). Recent insights on modulation of inflammasomes by adipokines: a critical event for the pathogenesis of obesity and metabolism-associated diseases. Archives of Pharmacal Research. https://doi.org/10.1007/s12272-020-01274-7

Alternate Names

CASP1, Caspase1, ICE

Gene Symbol

CASP1

Additional Caspase-1 Products

Product Documents for Recombinant Human Caspase-1 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human Caspase-1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...