Skip to main content

Recombinant Human CARD8 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00022900-Q02

Discontinued Product
H00022900-Q02 has been discontinued. View all CARD8 products.

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 232-328 of Human CARD8

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PSDALLTKAIDDEEDRFHGVRLQTSPPMEPLNFGSSYIVSNSANLKVMPKELKLSYRSPGEIQHFSKFYAGQMKEPIQLEITEKRHGTLVWDTEVKP

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Partial Recombinant Protein

Scientific Data Images for Recombinant Human CARD8 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00022900-Q02
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: CARD8

The protein encoded by this gene belongs to the caspase recruitment domain (CARD)-containing family of proteins, which are involved in pathways leading to activation of caspases or nuclear factor kappa-B (NFKB). This protein may be a component of the inflammasome, a protein complex that plays a role in the activation of proinflammatory caspases. It is thought that this protein acts as an adaptor molecule that negatively regulates NFKB activation, CASP1-dependent IL1B secretion, and apoptosis. Polymorphisms in this gene may be associated with a susceptibility to rheumatoid arthritis. Alternatively spliced transcript variants have been described for this gene, but their biological validity has not been determined. [provided by RefSeq]

Alternate Names

Apoptotic protein NDPP1, CARD inhibitor of NF-kappaB-activating ligands, CARDINALFLJ18121, CARD-inhibitor of NF-kappa-B-activating ligand, caspase recruitment domain family, member 8, caspase recruitment domain-containing protein 8, DACAR, Dakar, KIAA0955DKFZp779L0366, NDPP, NDPP1MGC57162, TUCANFLJ18119, Tumor up-regulated CARD-containing antagonist of CASP9, tumor up-regulated CARD-containing antagonist of caspase nine

Gene Symbol

CARD8

Additional CARD8 Products

Product Documents for Recombinant Human CARD8 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human CARD8 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...