Brorin/VWC2 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33745PEP
Key Product Details
Source
Conjugate
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: KLKQAWVSQGGGAKAGDLQVRPRGDTPQAEALAAAAQDAIGPELAPTPEPPEEYVYPDYR
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation and Storage
NBP2-33745PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: Brorin/VWC2
Brorin (brain-specific chordin-like protein), also called VWC2, is an ~46 kDa glycoprotein that is a member of the Chordin family of secreted BMP regulators. The human Brorin cDNA encodes 325 amino acids (aa) including a 27 aa signal sequence and a 298 aa secreted mature protein with two VWFC domains. These domains contain a pattern of 10 cysteine residues that is conserved in other family members, with the remaining aa sequence sharing little identity. Human Brorin shares 90%, 91%, and 95% aa sequence identity with mouse, rat, and equine Brorin, respectively. It also shares aa identity with VWC2L (Brorin-like) of 37% overall and 62% within the VWFC domains. Brorin is predominantly expressed in embryonic and adult neural tissues in the mouse. Expression of Brorin mRNA is concentrated in neurons within the diencephalon and medulla oblongata but is not detected in the developing cerebral cortex. Brorin binds and antagonizes BMPs, interacting via the VWFC domains. It promotes neurogenesis in mouse neural precursors. Knockdown of Brorin in zebrafish embryos results in morphological abnormalities in the brain and eye.
Long Name
Alternate Names
Gene Symbol
Additional Brorin/VWC2 Products
Product Documents for Brorin/VWC2 Recombinant Protein Antigen
Product Specific Notices for Brorin/VWC2 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.