Skip to main content

Recombinant Human ATP6V1C1 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00000528-P01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00000528-P01-25ug
H00000528-P01-10ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-382 of Human ATP6V1C1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

70.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human ATP6V1C1 GST (N-Term) Protein

SDS-PAGE: Recombinant Human ATP6V1C1 GST (N-Term) Protein [H00000528-P01]

SDS-PAGE: Recombinant Human ATP6V1C1 GST (N-Term) Protein [H00000528-P01]

SDS-Page: Recombinant Human ATP6V1C1 Protein [H00000528-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00000528-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: ATP6V1C1

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D. [provided by RefSeq]

Alternate Names

ATP6CH+-transporting ATPase chain C, vacuolar, ATP6Dsubunit C of vacuolar proton-ATPase V1 domain, ATPase, H+ transporting, lysosomal (vacuolar proton pump) 42kD, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C, isoform 1, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1, FLJ20057, H(+)-transporting two-sector ATPase, subunit C, vacuolar ATP synthase subunit C, vacuolar proton pump C subunit, Vacuolar proton pump subunit C 1, vacuolar proton pump, 42-kD subunit, vacuolar proton-ATPase, subunit C, VI domain, VATCH+ -ATPase C subunit, V-ATPase C subunit, V-ATPase subunit C 1, Vma5, V-type proton ATPase subunit C 1

Gene Symbol

ATP6V1C1

Additional ATP6V1C1 Products

Product Documents for Recombinant Human ATP6V1C1 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human ATP6V1C1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...