ASC/TMS1 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-49133PEP
Key Product Details
Source
Conjugate
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: GALLSMDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHR
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation and Storage
NBP2-49133PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: ASC
In regard to immune and inflammatory response, ASC/TMS1 is involved in inflammasome function (3-4). The inflammasome is a multiprotein complex that responds to cellular stress or pathogens and activates inflammatory responses. Specifically, ASC/TMS1 helps assemble the NLRP3 inflammasome complex which then activates caspase-1, followed by stimulation of proinflammatory cytokines including IL-1b and IL-18 (3-4). In terms of the role in regulating apoptosis, multiple studies have revealed that the ASC/TMS1 gene is hypermethylated in many cancers including breast, lung, glioblastomas, and melanomas (2-5). The increased methylation results in decreased gene expression, or silencing, allowing those cancer cells to escape apoptosis (2-5).
References
1. Masumoto, J., Taniguchi, S., Ayukawa, K., Sarvotham, H., Kishino, T., Niikawa, N., Hidaka, E., Katsuyama, T., Higuchi, T., & Sagara, J. (1999). ASC, a novel 22-kDa protein, aggregates during apoptosis of human promyelocytic leukemia HL-60 cells. The Journal of biological chemistry, 274(48), 33835-33838. https://doi.org/10.1074/jbc.274.48.33835
2. McConnell, B. B., & Vertino, P. M. (2004). TMS1/ASC: the cancer connection. Apoptosis: an international journal on programmed cell death. https://doi.org/10.1023/B:APPT.0000012117.32430.0c
3. Salminen, A., Kauppinen, A., Hiltunen, M., & Kaarniranta, K. (2014). Epigenetic regulation of ASC/TMS1 expression: potential role in apoptosis and inflammasome function. Cellular and molecular life sciences : CMLS. https://doi.org/10.1007/s00018-013-1524-9
4. Protti, M. P., & De Monte, L. (2020). Dual Role of Inflammasome Adaptor ASC in Cancer. Frontiers in cell and developmental biology. https://doi.org/10.3389/fcell.2020.00040
5. Parsons, M. J., & Vertino, P. M. (2006). Dual role of TMS1/ASC in death receptor signaling. Oncogene. https://doi.org/10.1038/sj.onc.1209684
Long Name
Alternate Names
Gene Symbol
Additional ASC Products
Product Documents for ASC/TMS1 Recombinant Protein Antigen
Product Specific Notices for ASC/TMS1 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.