Skip to main content

Ankyrin 1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33806PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-33806PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ANK1.

Source: E. coli

Amino Acid Sequence: FVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEEKELLDFVPKLDQVVESPAIPRIPCAMPETVVIRSEEQEQASKEYDEDSLIPSSP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33806.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-33806PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Ankyrin 1

Ankyrins are a family of proteins that link the integral membrane proteins to the underlying spectrin-actincytoskeleton and play key roles in activities such as cell motility, activation, proliferation, contact and themaintenance of specialized membrane domains. Multiple isoforms of ankyrin with different affinities for various targetproteins are expressed in a tissue-specific, developmentally regulated manner. Most ankyrins are typically composed ofthree structural domains: an amino-terminal domain containing multiple ankyrin repeats; a central region with a highlyconserved spectrin binding domain; and a carboxy-terminal regulatory domain which is the least conserved and subjectto variation. Ankyrin 1, the prototype of this family, was first discovered in the erythrocytes, but since has alsobeen found in brain and muscles. Mutations in erythrocytic ankyrin 1 have been associated in approximately half of allpatients with hereditary spherocytosis. Complex patterns of alternative splicing in the regulatory domain, giving riseto different isoforms of ankyrin 1 have been described. Truncated muscle-specific isoforms of ankyrin 1 resulting fromusage of an alternate promoter have also been identified. (provided by RefSeq)

Alternate Names

ANK, ANK-1, ankyrin 1, erythrocytic, ankyrin-1, Ankyrin-R, Erythrocyte ankyrin, SPH1, SPH2

Gene Symbol

ANK1

Additional Ankyrin 1 Products

Product Documents for Ankyrin 1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ankyrin 1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...