WDR79 Antibody [Biotin]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-75668

Fc Region Site-Specific Biotinylated Antibody
Catalog #
Availability
Size / Price
Qty
NBP3-75668
Print Quote
Bulk Order
Forumulation
Catalog #
BSA Free
NBP2-56099
View Product
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Biotin

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all WDR79 Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAGSAVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. Successful site-specific biotin conjugation is confirmed by reducing SDS-PAGE, revealing a mobility shift of the antibody heavy-chain when biotin is covalently attached. Additional information may be available upon request. The antibody concentration is provided on the individual product label. For specialized conjugation needs, like large quantities, and specific concentrations, bulk and custom antibody conjugation services are available.

Applications for WDR79 Antibody [Biotin]

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Recommended applications and dilutions are based on validated applications from the unconjugated base product NBP1-70338.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

40% glycerol and PBS (pH 7.2).

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: WDR79

WD-repeat domain 79 (WDR79) contains six WD (tryptophan-aspartate) repeat domains found in a number of proteins that function as adaptor molecules in signal transduction and cytoskeletal organization. The WD repeat is defined by four or more repeating units of a conserved core of approximately 40 amino acids ending with tryptophan-aspartic acid (WD). WD repeats may serve as sites of protein-protein interaction for adaptor proteins and facilitate multiprotein complex formation. The function of the WDR79 protein has not been characterized, however significant and consistent single nucleotide polymorphisms in the WDR79 gene have been found to be associated with ER negative breast cancer.

Alternate Names

FLJ10385, TCAB1WDR79telomerase Cajal body protein 1, WD repeat containing, antisense to TP53, WD repeat domain 79, WD repeat-containing protein 79, WD40 protein Wrap53, WD40 repeat-containing protein encoding RNA antisense to p53, WD-encoding RNA antisense to p53

Gene Symbol

WRAP53

Additional WDR79 Products

Product Documents for WDR79 Antibody [Biotin]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WDR79 Antibody [Biotin]

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy Policy
Cookie Policy
Site Map
© Copyright 2026 Bio-Techne. All Rights Reserved. All trademarks and registered trademarks are the property of Bio-Techne and its brands unless otherwise specified.