Transaldolase 1 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-88109

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-88109
NBP1-88109-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Transaldolase 1 Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MSSSPVKRQRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGRKLGGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Transaldolase 1 Antibody - BSA Free (NBP1-88109) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Transaldolase 1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Transaldolase 1 Antibody [NBP1-88109]

Immunocytochemistry/ Immunofluorescence: Transaldolase 1 Antibody [NBP1-88109]

Immunocytochemistry/Immunofluorescence: Transaldolase 1 Antibody [NBP1-88109] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Transaldolase 1 Antibody - BSA Free Western Blot: Transaldolase 1 Antibody - BSA Free [NBP1-88109]

Western Blot: Transaldolase 1 Antibody - BSA Free [NBP1-88109]

Analysis using Anti-TALDO1 antibody NBP1-88109 (A) shows similar pattern to independent antibody NBP2-56305 (B).
Transaldolase 1 Antibody - BSA Free Western Blot: Transaldolase 1 Antibody - BSA Free [NBP1-88109]

Western Blot: Transaldolase 1 Antibody - BSA Free [NBP1-88109]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
View 1 more images

Applications for Transaldolase 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Transaldolase 1

Transaldolase 1 is a key enzyme of the nonoxidative pentose phosphate pathway providing ribose-5-phosphate for nucleic acid synthesis and NADPH for lipid biosynthesis. This pathway can also maintain glutathione at a reduced state and thus protect sulfhydryl groups and cellular integrity from oxygen radicals. The functional gene of transaldolase 1 is located on chromosome 11 and a pseudogene is identified on chromosome 1 but there are conflicting map locations. The second and third exon of this gene were developed by insertion of a retrotransposable element. This gene is thought to be involved in multiple sclerosis. [provided by RefSeq]

Alternate Names

dihydroxyacetone transferase, EC 2.2.1.2, glycerone transferase, TAL, TALDO, TALDOR, TALH, TAL-H, transaldolase, transaldolase 1

Gene Symbol

TALDO1

Additional Transaldolase 1 Products

Product Documents for Transaldolase 1 Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Transaldolase 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.