Skip to main content

Thrombopoietin R/Tpo R Antibody (5Q9Z6)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15880

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-15880-100ul
NBP3-15880-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5Q9Z6 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 536-635 of human Thrombopoietin R/Tpo R (P40238). HRVLGQYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLGTMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

71 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit Thrombopoietin R/Tpo R Antibody (5Q9Z6) (NBP3-15880) is a recombinant monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Thrombopoietin R/Tpo R Antibody (5Q9Z6)

Western Blot: Thrombopoietin R/Tpo R Antibody (5Q9Z6) [NBP3-15880]

Western Blot: Thrombopoietin R/Tpo R Antibody (5Q9Z6) [NBP3-15880]

Western Blot: Thrombopoietin R/Tpo R Antibody (5Q9Z6) [NBP3-15880] - Western blot analysis of extracts of various cell lines, using Thrombopoietin R/Tpo R Rabbit mAb (NBP3-15880) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: Thrombopoietin R/Tpo R Antibody (5Q9Z6) [NBP3-15880]

Western Blot: Thrombopoietin R/Tpo R Antibody (5Q9Z6) [NBP3-15880]

Western Blot: Thrombopoietin R/Tpo R Antibody (5Q9Z6) [NBP3-15880] - Western blot analysis of extracts of various cell lines, using Thrombopoietin R/Tpo R Rabbit mAb (NBP3-15880) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

Applications for Thrombopoietin R/Tpo R Antibody (5Q9Z6)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Thrombopoietin R/Tpo R

In 1990 an oncogene, v-mpl, was identified from the murine myeloproliferative leukemia virus that was capable of immortalizing bone marrow hematopoietic cells from different lineages. In 1992 the human homologue, named, c-mpl, was cloned. Sequence data revealed that c-mpl encoded a protein that was homologous with members of the hematopoietic receptor superfamily. Presence of anti-sense oligodeoxynucleotides of c-mpl inhibited megakaryocyte colony formation. The ligand for c-mpl, thrombopoietin, was cloned in 1994. Thrombopoietin was shown to be the major regulator of megakaryocytopoiesis and platelet formation. The protein encoded by the c-mpl gene, CD110, is a 635 amino acid transmembrane domain, with two extracellular cytokine receptor domains and two intracellular cytokine receptor box motifs . TPO-R deficient mice were severely thrombocytopenic, emphasizing the important role of CD110 and thrombopoietin in megakaryocyte and platelet formation. Upon binding of thrombopoietin CD110 is dimerized and the JAK family of non-receptor tyrosine kinases, as well as the STAT family, the MAPK family, the adaptor protein Shc and the receptors themselves become tyrosine phosphorylated. [provided by RefSeq]

Long Name

Thrombopoietin Receptor

Alternate Names

c-Mpl, CD110, MPL, MPLV, TpoR

Gene Symbol

MPL

Additional Thrombopoietin R/Tpo R Products

Product Documents for Thrombopoietin R/Tpo R Antibody (5Q9Z6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Thrombopoietin R/Tpo R Antibody (5Q9Z6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...