Skip to main content

Syntrophin alpha 1 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16017

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-16017-100ul
NBP3-16017-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human Syntrophin alpha 1 (NP_003089.1). MASGRRAPRTGLLELRAGAGSGAGGERWQRVLLSLAEDVLTVSPADGDPGPEPGAPREQEPAQLNGAAEPGAGPPQLPEALLLQRRRVTV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Syntrophin alpha 1 Antibody - Azide and BSA Free (NBP3-16017) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Syntrophin alpha 1 Antibody - Azide and BSA Free

Western Blot: Syntrophin alpha 1 AntibodyAzide and BSA Free [NBP3-16017]

Western Blot: Syntrophin alpha 1 AntibodyAzide and BSA Free [NBP3-16017]

Western Blot: Syntrophin alpha 1 Antibody [NBP3-16017] - Western blot analysis of extracts of various cell lines, using Syntrophin alpha 1 antibody (NBP3-16017) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: Syntrophin alpha 1 AntibodyAzide and BSA Free [NBP3-16017]

Western Blot: Syntrophin alpha 1 AntibodyAzide and BSA Free [NBP3-16017]

Western Blot: Syntrophin alpha 1 Antibody [NBP3-16017] - Western blot analysis of extracts of various cell lines, using Syntrophin alpha 1 antibody (NBP3-16017) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunocytochemistry/ Immunofluorescence: Syntrophin alpha 1 Antibody - Azide and BSA Free [NBP3-16017]

Immunocytochemistry/ Immunofluorescence: Syntrophin alpha 1 Antibody - Azide and BSA Free [NBP3-16017]

Immunocytochemistry/Immunofluorescence: Syntrophin alpha 1 Antibody [NBP3-16017] - Immunofluorescence analysis of NIH/3T3 cells using Syntrophin alpha 1 Rabbit pAb (NBP3-16017) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Applications for Syntrophin alpha 1 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Syntrophin alpha 1

Dystrophin is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients. The protein encoded by this gene is a peripheral membrane protein found associated with dystrophin and dystrophin-related proteins. This gene is a member of the syntrophin gene family, which contains at least two other structurally-related genes.

Alternate Names

59 kDa dystrophin-associated protein A1 acidic component 1, dJ1187J4.5, LQT12, Pro-TGF-alpha cytoplasmic domain-interacting protein 1, SNT1alpha-1-syntrophin, syntrophin, alpha 1 (dystrophin-associated protein A1, 59kD, acidic component), syntrophin, alpha 1 (dystrophin-associated protein A1, 59kDa, acidic component), syntrophin-1, TACIP1acidic alpha 1 syntrophin

Gene Symbol

SNTA1

Additional Syntrophin alpha 1 Products

Product Documents for Syntrophin alpha 1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Syntrophin alpha 1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...