SARS Nucleocapsid Protein Antibody (AP201054) [CoraFluor™ 1]
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-90967CL1
Conjugate
Catalog #
Forumulation
Catalog #
Key Product Details
Species Reactivity
SARS-CoV, SARS-CoV-2
Applications
Western Blot, ELISA, Immunoassay, Direct ELISA, Immunocytochemistry/ Immunofluorescence
Label
CoraFluor 1
Antibody Source
Monoclonal Mouse IgG Clone # AP201054
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
The antibody was developed by immunizing mice with a with a protein fragment corresponding to amino acids 1-49 (C-MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN) from the N (SARS Nucleocapsid) for the Human SARS coronavirus (Genbank accession no. NP_828858.1)
Reactivity Notes
Use in SARS-CoV-2 reported in scientific literature (PMID:34944502) This antibody was selected for its ability to detect COVID-19 & SARS Coronavirus Nucleoprotein (NP) in direct ELISA. Immunogen displays the following percentage of sequence identity for non-tested species: COVID-19 (84%).
Clonality
Monoclonal
Host
Mouse
Isotype
IgG
Description
CoraFluor(TM) 1 is a high performance terbium-based TR-FRET (Time-Resolved Fluorescence Resonance Energy Transfer) or TRF (Time-Resolved Fluorescence) donor for high throughput assay development. CoraFluor(TM) 1 absorbs UV light at approximately 340 nm, and emits at approximately 490 nm, 545 nm, 585 nm and 620 nm. It is compatible with common acceptor dyes that absorb at the emission wavelengths of CoraFluor(TM) 1. CoraFluor(TM) 1 can be used for the development of robust and scalable TR-FRET binding assays such as target engagement, ternary complex, protein-protein interaction and protein quantification assays.
CoraFluor(TM) 1, amine reactive
CoraFluor(TM) 1, thiol reactive
For more information, please see our CoraFluor(TM) TR-FRET technology flyer.
CoraFluor(TM) 1, amine reactive
CoraFluor(TM) 1, thiol reactive
For more information, please see our CoraFluor(TM) TR-FRET technology flyer.
Scientific Data Images for SARS Nucleocapsid Protein Antibody (AP201054) [CoraFluor™ 1]
Product Feature: CoraFluor Probes for TR-FRET
CoraFluor™ 1, amine reactive (Catalog:7920) and CoraFluor™ 2, amine reactive (Catalog # 7950) are terbium-based probes that have been developed for use as TR-FRET donors. They emit wavelengths compatible with commonly used fluorescent acceptor dyes such as BODIPY® (or BDY) and Janelia Fluor® dyes, FITC (Catalog # 5440), TMR and Cyanine 5 (Catalog # 5436). CoraFluor™ fluorescence is brighter and more stable in biological media than existing TR-FRET donors, leading to enhanced sensitivity and improved data generation. CoraFluor™ 1 exhibits excitation upon exposure to a 337 nm UV laser.Applications for SARS Nucleocapsid Protein Antibody (AP201054) [CoraFluor™ 1]
Application
Recommended Usage
Direct ELISA
Optimal dilutions of this antibody should be experimentally determined.
ELISA
Optimal dilutions of this antibody should be experimentally determined.
Immunoassay
Optimal dilutions of this antibody should be experimentally determined.
Immunocytochemistry/ Immunofluorescence
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.
Formulation, Preparation, and Storage
Purification
Protein G purified
Formulation
PBS
Preservative
No Preservative
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C in the dark. Do not freeze.
Background: SARS Nucleocapsid Protein
Alternate Names
N, N protein, N structural protein, NC, Nucleocapsid protein, Nucleoprotein, Protein N, SARS coronavirus N protein, SARS coronavirus nucleocapsid protein, SARS CoV, SARS CoV N protein, SARS CoV nucleocapsid protein, SARS N protein, SARS Nucleoprotein, SARSCoV, SARSCoV N protein, SARSCoV nucleocapsid protein, Severe acute respiratory syndrome
Gene Symbol
N
Additional SARS Nucleocapsid Protein Products
Product Documents for SARS Nucleocapsid Protein Antibody (AP201054) [CoraFluor™ 1]
Product Specific Notices for SARS Nucleocapsid Protein Antibody (AP201054) [CoraFluor™ 1]
CoraFluor (TM) is a trademark of Bio-Techne Corp. Sold for research purposes only under agreement from Massachusetts General Hospital. US patent 2022/0025254
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...