Skip to main content

SARS-CoV-2 ORF8 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-07972

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-07972

Key Product Details

Species Reactivity

SARS-CoV-2

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Sequence: MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

13 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit SARS-CoV-2 ORF8 Antibody - Azide and BSA Free (NBP3-07972) is a polyclonal antibody validated for use in WB and ELISA. Anti-SARS-CoV-2 ORF8 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for SARS-CoV-2 ORF8 Antibody - Azide and BSA Free

Western Blot: SARS-CoV-2 ORF8 AntibodyAzide and BSA Free [NBP3-07972]

Western Blot: SARS-CoV-2 ORF8 AntibodyAzide and BSA Free [NBP3-07972]

Western Blot: SARS-CoV-2 ORF8 Antibody [NBP3-07972] - Various lysates were subjected to SDS-PAGE followed by western blot with SARS-CoV-2 (2019-nCoV) ORF8 Protein antibody at dilution of 1:1000.

Applications for SARS-CoV-2 ORF8 Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

1:4000-1:8000

Formulation, Preparation, and Storage

Purification

Antigen Affinity-purified

Formulation

PBS (pH 7.4), 50% Glycerol

Format

Azide and BSA Free

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SARS-CoV-2 ORF8

SARS-CoV-2 Open Reading Frame 8 (ORF8) is one of the nine downstream accessory protein open reading frames of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). SARS-CoV-2 ORF8 is 121 amino acids (aa) in length with a theoretical molecular weight of 13.8 kDa (2, 3). One particular difference between SARS-CoV-2 and SARS-CoV is that SARS-CoV-2 has one ORF8 protein, while SARS-CoV has two ORF8 proteins (ORF8a and ORF8b) (3). The aa sequence alignment of SARS-CoV-2's ORF8 has 31.7% sequence identity and 70.7% sequence similarity with SARS-CoV ORF8a (3). Furthermore, SARS-CoV-2 ORF8 has a 40.5% sequence identity and 66.7% sequence similarity is with SARS-CoV ORF8b (3). Despite this low sequence identity and similarity, the ORF8 structure and function appears to be well conserved (4). Both ORF8 proteins appear to be localized to the ER and have an N-terminal hydrophobic region, a conserved glycosylation site, and cysteine residues capable of forming disulfide bonds (4).

Studies have revealed that SARS-CoV-2 ORF8 has a role in host immune suppression during viral infection as it is an inhibitor of the type I interferon pathway (4, 5). Specifically, ORF8 has been shown to have antagonistic properties on interferon-beta (IFN-beta), the NF-kappabeta-responsive promoter, and the interferon-stimulated response element (ISRE) (4,5). Additionally, ORF8 colocalizes with the ER and lysosomal proteins Calnexin and LAMP1, playing a role in major histocompatibility complex class I (MHC-I) downregulation and degradation (4, 6). These results suggest that inhibiting ORF8 may be a potential approach for improving immune surveillance and more quickly eliminating SARS-CoV-2 infection (4-6).

References

1. Michel, C. J., Mayenr, C., Poch, O., & Thompson, J. D. (2020). Characterization of accessory genes in coronavirus genomes. Virology journal. https://doi.org/10.1186/s12985-020-01402-1

2. UniProt (P0DTC8)

3. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The protein journal. https://doi.org/10.1007/s10930-020-09901-4

4. Mohammad, S., Bouchama, A., Mohammad Alharbi, B., Rashid, M., Saleem Khatlani, T., Gaber, N. S., & Malik, S. S. (2020). SARS-CoV-2 ORF8 and SARS-CoV ORF8ab: Genomic Divergence and Functional Convergence. Pathogens (Basel, Switzerland). https://doi.org/10.3390/pathogens9090677

5. Li, J. Y., Liao, C. H., Wang, Q., Tan, Y. J., Luo, R., Qiu, Y., & Ge, X. Y. (2020). The ORF6, ORF8 and nucleocapsid proteins of SARS-CoV-2 inhibit type I interferon signaling pathway. Virus research. https://doi.org/10.1016/j.virusres.2020.198074

6. Zhang Y., Zhang J., Chen Y., Luo B., Yuan Y., Huang F., Yang T., Yu F., Liu J., Liu B., et al. (2020). The ORF8 Protein of SARS-CoV-2 Mediates Immune Evasion through Potently Downregulating MHC-I. bioRxiv. https://doi.org/10.1101/2020.05.24.111823.

Alternate Names

2019-nCoV ORF8, 2019-nCoV ORF8 Protein, COVID-19 Non-structural protein 8, COVID-19 ns8, COVID-19 ORF8, Human coronavirus ORF8 Protein, Non-structural protein 8, ns8, ORF8 protein, SARS-CoV-2, SARS-CoV-2 Non-structural protein 8, SARS-CoV-2 ns8, SARSCoV2 ORF8 Protein, SARS-CoV-2 ORF8 Protein, Severe Acute Respiratory Syndrome Coronavirus 2 ORF8 Protein

Gene Symbol

ORF8

Additional SARS-CoV-2 ORF8 Products

Product Documents for SARS-CoV-2 ORF8 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SARS-CoV-2 ORF8 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...