Rev-erb beta/NR1D2 Antibody - BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56141
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPLSKSP
Reactivity Notes
Mouse 85%.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Rev-erb beta/NR1D2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: Rev-erb beta/NR1D2 Antibody [NBP2-56141]
Immunocytochemistry/Immunofluorescence: Rev-erb beta/NR1D2 Antibody [NBP2-56141] - Staining of human cell line PC-3 shows localization to nucleoplasm.Immunohistochemistry: Rev-erb beta/NR1D2 Antibody [NBP2-56141] -
Immunohistochemistry: Rev-erb beta/NR1D2 Antibody [NBP2-56141] - Cancer cells from small cell carcinoma employ highly divergent regulatory program compared to adenocarcinoma cells.a,b, Gene set expression scores of single G1 cells using expression signature of NEPC18 (a) & set of genes regulated by AR17 (b). Box plots: center line, median; box limits, upper & lower quartiles; whiskers extend at most 1.5× interquartile range past upper & lower quartiles; P values from 2-sided Mann–Whitney U-test. c, Inferred activity of regulons of different transcriptional regulators. x axis, q values from comparison of inferred regulon activity in cancer cells from small cell carcinoma (n = 76) vs cancer cells from adenocarcinomas (n = 188, sampled as described in Methods) (negative values indicate regulon is less active in small cell carcinoma; two-sided Mann–Whitney U-test, median outcome of sampling iterations (Methods) w/ Bonferroni FWER correction). y axis: P values (two-sided Mann–Whitney U-test, signed as previous) from comparison of expression scores of scRNA-derived regulons in bulk RNA-seq of small cell carcinomas (n = 8) vs adenocarcinomas (n = 18) from a published cohort8. d, Regulon activity in single cells for select transcriptional regulators. e, Hierarchical clustering of bulk RNA-seq of a published cohort of prostate cancers of known histopathology18 based on expression of HOXB5, HOXB6 & NR1D2 regulons inferred from scRNA-seq. B–E correspond to different NEPC subtype labels from original publication. Expression levels of EZH2, NANOG & SOX2 shown for reference but not used in clustering (n = 34 adenocarcinoma, 15 NEPC). f, IHC staining of HOXB5, HOXB6 & NR1D2 protein levels in two prostate adenocarcinoma xenografts (LNCaP & VCaP) & four NEPC patient-derived organoids. Scale bar: 50 μm. Image collected & cropped by CiteAb from following publication (https://pubmed.ncbi.nlm.nih.gov/33664492), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Chromatin Immunoprecipitation-exo-Seq: Rev-erb beta/NR1D2 Antibody - BSA Free [NBP2-56141]
ChIP-Exo-Seq composite graph for Anti-NR1D2 (NBP2-56141) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.Applications for Rev-erb beta/NR1D2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Western Blot
0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Rev-erb beta/NR1D2
Alternate Names
BD73, EAR-1R, NR1D2, Reverb beta
Gene Symbol
NR1D2
Additional Rev-erb beta/NR1D2 Products
Product Documents for Rev-erb beta/NR1D2 Antibody - BSA Free
Product Specific Notices for Rev-erb beta/NR1D2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...