RASAL3 Antibody - BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-83439
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Mouse
Applications
Validated:
Western Blot
Cited:
Immunohistochemistry
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Concentration
0.5 mg/ml
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human RASAL3. Peptide sequence: PRKPSVPWQRQMDQPQDRNQALGTHRPVNKLAELQCEVAALREEQKVLSR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for RASAL3 Antibody - BSA Free
Western Blot: RASAL3 Antibody [NBP2-83439]
Western Blot: RASAL3 Antibody [NBP2-83439] - Host: Rabbit. Target Name: RASAL3. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/mlWestern Blot: RASAL3 Antibody - BSA Free [NBP2-83439] -
ALKBH5 exerts cardioprotective effects by promoting the Ras/Raf/Erk signaling pathway via m6A demethylation of Rasal3 mRNA(A) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KO-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown.(B) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KO-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(C) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KO-CM-DOX and WT-CM-DOX after OE-Rasal3 overexpression.(D) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KO-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(E) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KI-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown.(F) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KI-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(G) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KI-CM-DOX and WT-CM-DOX after OE-Rasal3 overexpression.(H) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KI-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(I) A proposed model showing how ALKBH5 mediates mitochondrial dysfunction to induce CM death and mitigate DIC injury. Data are depicted as the mean +/- SEM. Statistical significance was determined by Student’s t test or one-way ANOVA or two-way ANOVA with a post-hoc Holm-Sidak test. Here, ns, not significant; ∗p < 0.05; ∗∗p < 0.05; ∗∗∗p < 0.001; ∗∗∗∗p < 0.0001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36876119), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: RASAL3 Antibody - BSA Free [NBP2-83439] -
ALKBH5 exerts cardioprotective effects by promoting the Ras/Raf/Erk signaling pathway via m6A demethylation of Rasal3 mRNA(A) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KO-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown.(B) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KO-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(C) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KO-CM-DOX and WT-CM-DOX after OE-Rasal3 overexpression.(D) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KO-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(E) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KI-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown.(F) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KI-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(G) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KI-CM-DOX and WT-CM-DOX after OE-Rasal3 overexpression.(H) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KI-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(I) A proposed model showing how ALKBH5 mediates mitochondrial dysfunction to induce CM death and mitigate DIC injury. Data are depicted as the mean +/- SEM. Statistical significance was determined by Student’s t test or one-way ANOVA or two-way ANOVA with a post-hoc Holm-Sidak test. Here, ns, not significant; ∗p < 0.05; ∗∗p < 0.05; ∗∗∗p < 0.001; ∗∗∗∗p < 0.0001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36876119), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for RASAL3 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: RASAL3
Alternate Names
RAS Protein Activator Like 3, RAS Protein Activator Like-3
Gene Symbol
RASAL3
Additional RASAL3 Products
Product Specific Notices for RASAL3 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...